From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004126000
  • symbol?: glk
  • description?: glucokinase

      descriptions from strain specific annotations:

    • glucokinase
    • glucokinase (Glucose kinase)
    • putative glucokinase, ROK family
    • ROK family glucokinase
    • ROK family protein
  • strand?: -
  • coordinates?: 4396947..4397933
  • synteny block?: BlockID0031560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1604 (glk)
    N315:
    SA1377 (glcK)
    NCTC8325:
    Newman:
    NWMN_1451 (glk)
    USA300_FPR3757:
    04-02981:
    SA2981_1505 (glcK)
    08BA02176:
    C248_1590 (glkA)
    11819-97:
    MS7_1564
    71193:
    ST398NM01_1612
    ECT-R 2:
    ECTR2_1398
    ED133:
    SAOV_1547
    ED98:
    SAAV_1539 (glk)
    HO 5096 0412:
    SAEMRSA15_14670 (glkA)
    JH1:
    SaurJH1_1639
    JH9:
    SaurJH9_1605
    JKD6008:
    SAA6008_01517 (glcK)
    JKD6159:
    SAA6159_01482 (glcK)
    LGA251:
    SARLGA251_14530 (glkA)
    M013:
    M013TW_1562
    MRSA252:
    SAR1624 (glkA)
    MSHR1132:
    SAMSHR1132_13880
    MSSA476:
    SAS1485
    Mu3:
    SAHV_1534 (glcK)
    Mu50:
    SAV1547 (glcK)
    MW2:
    MW1499 (glcK)
    RF122:
    SAB1419c (glkA)
    ST398:
    SAPIG1612
    T0131:
    SAT0131_01641
    TCH60:
    HMPREF0772_11594 (glk)
    TW20:
    SATW20_15430 (glkA)
    USA300_TCH1516:
    USA300HOU_1549 (glcK)
    VC40:
    SAVC_06980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
    N315            MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
    NCTC8325        MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
    Newman          MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
    USA300_FPR3757  MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
                    ************************************************************

    COL             YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
    N315            YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
    NCTC8325        YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
    Newman          YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
    USA300_FPR3757  YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
                    ************************************************************

    COL             LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
    N315            LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
    NCTC8325        LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
    Newman          LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
    USA300_FPR3757  LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
                    ************************************************************

    COL             GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
    N315            GRSGCIETVASATGVVNLINFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
    NCTC8325        GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
    Newman          GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
    USA300_FPR3757  GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
                    ******************:*****************************************

    COL             TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
    N315            TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
    NCTC8325        TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
    Newman          TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
    USA300_FPR3757  TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
                    ************************************************************

    COL             QAKLGNDAGITGAAGLIKTYVLDKEGVK
    N315            QAKLGNDAGITGAAGLIKTYVLDKEGVK
    NCTC8325        QAKLGNDAGITGAAGLIKTYVLDKEGVK
    Newman          QAKLGNDAGITGAAGLIKTYVLDKEGVK
    USA300_FPR3757  QAKLGNDAGITGAAGLIKTYVLDKEGVK
                    ****************************