From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan004127000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4397930..4398133
  • synteny block?: BlockID0031570
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1506
    08BA02176:
    C248_1591
    11819-97:
    MS7_1565
    71193:
    ST398NM01_1613
    ECT-R 2:
    ED133:
    SAOV_1548
    ED98:
    SAAV_1540
    HO 5096 0412:
    SAEMRSA15_14680
    JH1:
    SaurJH1_1640
    JH9:
    SaurJH9_1606
    JKD6008:
    JKD6159:
    SAA6159_01483
    LGA251:
    SARLGA251_14540
    M013:
    M013TW_1563
    MRSA252:
    SAR1625
    MSHR1132:
    MSSA476:
    SAS1486
    Mu3:
    SAHV_1535
    Mu50:
    SAV1548
    MW2:
    MW1500
    RF122:
    SAB1420c
    ST398:
    SAPIG1613
    T0131:
    TCH60:
    HMPREF0772_11593
    TW20:
    SATW20_15440
    USA300_TCH1516:
    USA300HOU_1550
    VC40:
    SAVC_06985

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSRKINNFYDVQQLLKSYGFLIYFKNPEDMYEMIQQEISSLYQYELLSKEEYLKCTLIIN
    N315            MSRKINNFYDVQQLLKSYGFLIYFKNPEDMYEMIQQEISSLYQYELLSKEEYLKCTLIIN
    NCTC8325        MSRKINNFYDVQQLLKSYGFLIYFKNPEDMYEMIQQEISSLYQYELLSKEEYLKCTLIIN
    USA300_FPR3757  MSRKINNFYDVQQLLKSYGFLIYFKNPEDMYEMIQQEISSLYQYELLSKEEYLKCTLIIN
                    ************************************************************

    COL             QRRNEQK
    N315            QRRNEQK
    NCTC8325        QRRNEQK
    USA300_FPR3757  QRRNEQK
                    *******