From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004135000
  • symbol?: zur
  • description?: ferric uptake regulator-like protein

      descriptions from strain specific annotations:

    • ferric uptake regulator-like protein
    • ferric uptake regulator family protein
    • ferric-uptake regulator
    • FUR family transcriptional regulator
    • Zinc uptake regulation protein ZUR
    • zinc-specific metallo-regulatory protein
    • ferric uptake regulation protein
    • ferric uptake regulation protein (Ferric uptake regulator)
    • Fur family transcriptional regulator ZurR
  • strand?: -
  • coordinates?: 4403688..4404098
  • synteny block?: BlockID0031650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1512
    08BA02176:
    C248_1597 (zur)
    11819-97:
    MS7_1571 (zur)
    71193:
    ST398NM01_1619
    ECT-R 2:
    ECTR2_1404
    ED133:
    SAOV_1554 (zur)
    ED98:
    SAAV_1546
    HO 5096 0412:
    SAEMRSA15_14740 (zur)
    JH1:
    SaurJH1_1646
    JH9:
    SaurJH9_1612
    JKD6008:
    SAA6008_01523
    JKD6159:
    SAA6159_01489
    LGA251:
    SARLGA251_14600 (zur)
    M013:
    M013TW_1569
    MRSA252:
    SAR1631 (zur)
    MSHR1132:
    SAMSHR1132_13940
    MSSA476:
    SAS1492
    Mu3:
    SAHV_1541
    Mu50:
    SAV1554
    MW2:
    MW1506
    RF122:
    SAB1426c (zur)
    ST398:
    SAPIG1619
    T0131:
    SAT0131_01648
    TCH60:
    HMPREF0772_11586 (zurR)
    TW20:
    SATW20_15500 (zur)
    USA300_TCH1516:
    USA300HOU_1556
    VC40:
    SAVC_07020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNL
    N315            MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNL
    NCTC8325        MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNL
    Newman          MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNL
    USA300_FPR3757  MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNL
                    ************************************************************

    COL             HLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNI
    N315            HLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNI
    NCTC8325        HLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNI
    Newman          HLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNI
    USA300_FPR3757  HLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNI
                    ************************************************************

    COL             HKHKLEVYGVCESCQD
    N315            HKHKLEVYGVCESCQD
    NCTC8325        HKHKLEVYGVCESCQD
    Newman          HKHKLEVYGVCESCQD
    USA300_FPR3757  HKHKLEVYGVCESCQD
                    ****************