From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004137000
  • symbol?: znuC
  • description?: zinc ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • zinc ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • ABC transporter
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter family protein
    • ABC transporter-like protein
    • ABC transporter MreA
    • ABC transporter protein
    • ABC-type Mn/Zn transporter
    • High-affinity zinc uptake system ATP-binding protein
    • zinc ABC transporter
    • Zinc ABC transporter, ATP-binding protein ZnuC
    • Zinc ABC transporter ATP-binding protein ZnuC
    • zinc uptake system ATP-binding protein zurA
  • strand?: -
  • coordinates?: 4404990..4405757
  • synteny block?: BlockID0031670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1514 (znuC)
    08BA02176:
    C248_1599 (mreA)
    11819-97:
    MS7_1573
    71193:
    ST398NM01_1621
    ECT-R 2:
    ECTR2_1406
    ED133:
    SAOV_1556 (mreA)
    ED98:
    SAAV_1548
    HO 5096 0412:
    SAEMRSA15_14760 (mreA)
    JH1:
    SaurJH1_1648
    JH9:
    SaurJH9_1614
    JKD6008:
    SAA6008_01525 (znuC)
    JKD6159:
    SAA6159_01491 (znuC)
    LGA251:
    SARLGA251_14620 (mreA)
    M013:
    M013TW_1571
    MRSA252:
    SAR1633 (mreA)
    MSHR1132:
    SAMSHR1132_13960
    MSSA476:
    SAS1494
    Mu3:
    SAHV_1543
    Mu50:
    SAV1556
    MW2:
    MW1508
    RF122:
    SAB1428c (mreA)
    ST398:
    SAPIG1621
    T0131:
    SAT0131_01650
    TCH60:
    HMPREF0772_11584
    TW20:
    SATW20_15520 (mreA)
    USA300_TCH1516:
    USA300HOU_1558
    VC40:
    SAVC_07030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRGENTMTPVFELKNVNYYYDHKKVLENINIKINKGEFLAIVGPNGAGKSTLLKLILGLL
    N315            ------MTPVFELKNVNYYYDHKKVLENINIKINKGEFLAIVGPNGAGKSTLLKLILGLL
    NCTC8325        MRGENTMTPVFELKNVNYYYDHKKVLENINIKINKGEFLAIVGPNGAGKSTLLKLILGLL
    Newman          MRGENTMTPVFELKNVNYYYDHKKVLENINIKINKGEFLAIVGPNGAGKSTLLKLILGLL
    USA300_FPR3757  MRGENTMTPVFELKNVNYYYDHKKVLENINIKINKGEFLAIVGPNGAGKSTLLKLILGLL
                          ******************************************************

    COL             PLQSGEIFVEGIDFKNKKTSIKLSYVSQKANAFNSGFPASVKEVVLSGLTKTKRLFQTFN
    N315            PLQSGEIFVEGIDFKNKKTSIKLSYVSQKANAFNSGFPASVKEVVLSGLTKTKRLFQTFN
    NCTC8325        PLQSGEIFVEGIDFKNKKTSIKLSYVSQKANAFNSGFPASVKEVVLSGLTKTKRLFQTFN
    Newman          PLQSGEIFVEGIDFKNKKTSIKLSYVSQKANAFNSGFPASVKEVVLSGLTKTKRLFQTFN
    USA300_FPR3757  PLQSGEIFVEGIDFKNKKTSIKLSYVSQKANAFNSGFPASVKEVVLSGLTKTKRLFQTFN
                    ************************************************************

    COL             SKDNEKVIKVLERLNISDLIHKNIAELSGGQQQRVMIARALISEPAVLVLDEPTNGIDAK
    N315            SKDNEKVIKVLERLNISDLIHKNIAELSGGQQQRVMIARALISEPAVLVLDEPTNGIDAK
    NCTC8325        SKDNEKVIKVLERLNISDLIHKNIAELSGGQQQRVMIARALISEPAVLVLDEPTNGIDAK
    Newman          SKDNEKVIKVLERLNISDLIHKNIAELSGGQQQRVMIARALISEPAVLVLDEPTNGIDAK
    USA300_FPR3757  SKDNEKVIKVLERLNISDLIHKNIAELSGGQQQRVMIARALISEPAVLVLDEPTNGIDAK
                    ************************************************************

    COL             HVSEFYNTLDQLKQEGITIILVTHDIGVVADTATEVACLNKHLHFHGTTDEFKSLDEVEI
    N315            HVSEFYNTLDQLKQEGITIILVTHDIGVVADTATEVACLNKHLHFHGTTDEFKSLDEVEI
    NCTC8325        HVSEFYNTLDQLKQEGITIILVTHDIGVVADTATEVACLNKHLHFHGTTDEFKSLDEVEI
    Newman          HVSEFYNTLDQLKQEGITIILVTHDIGVVADTATEVACLNKHLHFHGTTDEFKSLDEVEI
    USA300_FPR3757  HVSEFYNTLDQLKQEGITIILVTHDIGVVADTATEVACLNKHLHFHGTTDEFKSLDEVEI
                    ************************************************************

    COL             SKIYGHPVRFVDHQHNRECCN
    N315            SKIYGHPVRFVDHQHNRECCN
    NCTC8325        SKIYGHPVRFVDHQHNRECCN
    Newman          SKIYGHPVRFVDHQHNRECCN
    USA300_FPR3757  SKIYGHPVRFVDHQHNRECCN
                    *********************