From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004141000
  • symbol?: trmK
  • description?: Putative tRNA-m1A22 methylase

      descriptions from strain specific annotations:

    • Putative tRNA-m1A22 methylase
    • tRNA (adenine-N(1)-)-methyltransferase TrmK
    • SAM-dependent methyltransferase
    • Bcl-2 family protein
  • strand?: -
  • coordinates?: 4409364..4410041
  • synteny block?: BlockID0031710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1518
    08BA02176:
    C248_1603
    11819-97:
    MS7_1577 (trmK)
    71193:
    ST398NM01_1625
    ECT-R 2:
    ECTR2_1410
    ED133:
    SAOV_1560
    ED98:
    SAAV_1552
    HO 5096 0412:
    SAEMRSA15_14800
    JH1:
    SaurJH1_1652
    JH9:
    SaurJH9_1618
    JKD6008:
    SAA6008_01529
    JKD6159:
    SAA6159_01495
    LGA251:
    SARLGA251_14660
    M013:
    M013TW_1575
    MRSA252:
    SAR1637
    MSHR1132:
    SAMSHR1132_14000
    MSSA476:
    SAS1498
    Mu3:
    SAHV_1547
    Mu50:
    SAV1560
    MW2:
    MW1512
    RF122:
    SAB1432c
    ST398:
    SAPIG1625
    T0131:
    SAT0131_01654
    TCH60:
    HMPREF0772_11580
    TW20:
    SATW20_15560
    USA300_TCH1516:
    USA300HOU_1562
    VC40:
    SAVC_07050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISLNNRLTTVSCFLKQGTIADIGSDHAYLPIYAIQNHLCECGIAGEVIQGPFQAAVKNV
    N315            MISLNNRLTTVSRFLKQGTIADIGSDHAYLPIYAIQNHLCECGIAGEVIQGPFQAAVKNV
    NCTC8325        MISLNNRLTTVSRFLKQGTIADIGSDHAYLPIYAIQNHLCECGIAGEVIQGPFQAAVKNV
    Newman          MISLNNRLTTVSRFLKQGTIADIGSDHAYLPIYAIQNHLCECGIAGEVIQGPFQAAVKNV
    USA300_FPR3757  MISLNNRLTTVSRFLKQGTIADIGSDHAYLPIYAIQNHLCECGIAGEVIQGPFQAAVKNV
                    ************ ***********************************************

    COL             AANQLVDRIDVRLGDGLSVIQPEDVIDNITICGMGGPLIAKILKDGQDKLSQHPRLILQS
    N315            AANHLVERIDVRLGDGLSVIHPEDVIDNITICGMGGPLIAKILKDGQDKLSQHPRLILQS
    NCTC8325        AANQLVDRIDVRLGDGLSVIQPEDVIDNITICGMGGPLIAKILKDGQDKLSQHPRLILQS
    Newman          AANQLVDRIDVRLGDGLSVIQPEDVIDNITICGMGGPLIAKILKDGQDKLSQHPRLILQS
    USA300_FPR3757  AANQLVDRIDVRLGDGLSVIQPEDVIDNITICGMGGPLIAKILKDGQDKLSQHPRLILQS
                    ***:**:*************:***************************************

    COL             NIQTENLRQTLQQLNYEIIDEIIMEEKGHIYEIVVAEYSTELIELSSDELKFGPKLLNNK
    N315            NIQTENLRQTLQQLNYEIIDEIIMEEKGHIYEIVVAEHSTQLIELSSDELKFGPKLLNNK
    NCTC8325        NIQTENLRQTLQQLNYEIIDEIIMEEKGHIYEIVVAEYSTELIELSSDELKFGPKLLNNK
    Newman          NIQTENLRQTLQQLNYEIIDEIIMEEKGHIYEIVVAEYSTELIELSSDELKFGPKLLNNK
    USA300_FPR3757  NIQTENLRQTLQQLNYEIIDEIIMEEKGHIYEIVVAEYSTELIELSSDELKFGPKLLNNK
                    *************************************:**:*******************

    COL             NEYFIKKWQRELEALYHIKSKLNTEQHHQRLAQINDEIAVIERVL
    N315            NEYFIKKWQRELEALYHIKSKLNTEQHHQRLAQINDEIAVIERVL
    NCTC8325        NEYFIKKWQRELEALYHIKSKLNTEQHHQRLAQINDEIAVIERVL
    Newman          NEYFIKKWQRELEALYHIKSKLNTEQHHQRLAQINDEIAVIERVL
    USA300_FPR3757  NEYFIKKWQRELEALYHIKSKLNTEQHHQRLAQINDEIAVIERVL
                    *********************************************