From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004144000
  • symbol?:
  • description?: ATP/GTP-binding protein

      descriptions from strain specific annotations:

    • ATP/GTP-binding protein
    • ATP/GTP-binding protein , SA1392-like protein
    • PEP synthetase regulatory protein
    • Putative phosphotransferase
    • putative phosphotransferase yqfL
    • protein in Sigma70 operon (ORF30)
  • strand?: -
  • coordinates?: 4413381..4414199
  • synteny block?: BlockID0031740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1521
    08BA02176:
    C248_1606
    11819-97:
    MS7_1580 (yqfL)
    71193:
    ST398NM01_1628
    ECT-R 2:
    ECTR2_1413
    ED133:
    SAOV_1563
    ED98:
    SAAV_1555
    HO 5096 0412:
    SAEMRSA15_14830
    JH1:
    SaurJH1_1655
    JH9:
    SaurJH9_1621
    JKD6008:
    SAA6008_01532
    JKD6159:
    SAA6159_01498
    LGA251:
    SARLGA251_14690 (yqfL)
    M013:
    M013TW_1578
    MRSA252:
    SAR1640
    MSHR1132:
    SAMSHR1132_14030
    MSSA476:
    SAS1501
    Mu3:
    SAHV_1550
    Mu50:
    SAV1563
    MW2:
    MW1515
    RF122:
    SAB1435c
    ST398:
    SAPIG1628
    T0131:
    SAT0131_01658
    TCH60:
    HMPREF0772_11577
    TW20:
    SATW20_15590 (yqfL)
    USA300_TCH1516:
    USA300HOU_1565
    VC40:
    SAVC_07065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKIKIIVASDSIGETAELVARAGISQFNPKQCKNELLRYPYIESFEDVDEVIQVAKDTN
    N315            MEKIKIIVASDSIGETAELVARAGISQFNPKQCKNELLRYPYIESFEDVDEVIQVAKDTN
    NCTC8325        MEKIKIIVASDSIGETAELVARAGISQFNPKQCKNELLRYPYIESFEDVDEVIQVAKDTN
    Newman          MEKIKIIVASDSIGETAELVARAGISQFNPKQCKNELLRYPYIESFEDVDEVIQVAKDTN
    USA300_FPR3757  MEKIKIIVASDSIGETAELVARAGISQFNPKQCKNELLRYPYIESFEDVDEVIQVAKDTN
                    ************************************************************

    COL             AIIVYTLIKPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAY
    N315            AIIVYTLIKPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAY
    NCTC8325        AIIVYTLIKPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAY
    Newman          AIIVYTLIKPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAY
    USA300_FPR3757  AIIVYTLIKPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAY
                    ************************************************************

    COL             FKKIDAIEFAVKYDDGKDPKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEV
    N315            FKKIDAIEFAVKYDDGKDPKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEV
    NCTC8325        FKKIDAIEFAVKYDDGKDPKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEV
    Newman          FKKIDAIEFAVKYDDGKDPKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEV
    USA300_FPR3757  FKKIDAIEFAVKYDDGKDPKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEV
                    ************************************************************

    COL             TPPDGLYDINPKKCIALKISEEKLNRIRKERLKQLGLGDTARYATEARIQEELNYFEEIV
    N315            TPPDGLYDIDPKKCIALKISEEKLNRIRKERLKQLGLGDTARYATEARIQEELNYFEEIV
    NCTC8325        TPPDGLYDINPKKCIALKISEEKLNRIRKERLKQLGLGDTARYATEARIQEELNYFEEIV
    Newman          TPPDGLYDINPKKCIALKISEEKLNRIRKERLKQLGLGDTARYATEARIQEELNYFEEIV
    USA300_FPR3757  TPPDGLYDINPKKCIALKISEEKLNRIRKERLKQLGLGDTARYATEARIQEELNYFEEIV
                    *********:**************************************************

    COL             SEIGCPVIDVSQKAIEETANDIIHYIEQNKSK
    N315            SEIGCPVIDVSQKAIEETANDIIHYIEQNKSK
    NCTC8325        SEIGCPVIDVSQKAIEETANDIIHYIEQNKSK
    Newman          SEIGCPVIDVSQKAIEETANDIIHYIEQNKSK
    USA300_FPR3757  SEIGCPVIDVSQKAIEETANDIIHYIEQNKSK
                    ********************************