From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004151000
  • symbol?: dgkA
  • description?: diacylglycerol kinase

      descriptions from strain specific annotations:

    • diacylglycerol kinase
    • diacylglycerol kinase (DAGK) (Diglyceride kinase)(DGK)
    • putative diacylglycerol kinase
    • prokaryotic diacylglycerol kinase family protein
  • strand?: -
  • coordinates?: 4418838..4419101
  • synteny block?: BlockID0031810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1626 (dgkA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1527
    08BA02176:
    C248_1612
    11819-97:
    MS7_1586
    71193:
    ST398NM01_1634
    ECT-R 2:
    ECTR2_1419
    ED133:
    SAOV_1569
    ED98:
    SAAV_1561 (dgkA)
    HO 5096 0412:
    SAEMRSA15_14890
    JH1:
    SaurJH1_1661
    JH9:
    SaurJH9_1627
    JKD6008:
    SAA6008_01539 (dgkA)
    JKD6159:
    SAA6159_01504 (dgkA)
    LGA251:
    SARLGA251_14750
    M013:
    M013TW_1584
    MRSA252:
    SAR1646
    MSHR1132:
    SAMSHR1132_14090
    MSSA476:
    SAS1507
    Mu3:
    SAHV_1556
    Mu50:
    SAV1569
    MW2:
    MW1521
    RF122:
    SAB1441c
    ST398:
    SAPIG1634
    T0131:
    SAT0131_01665 (hpt)
    TCH60:
    HMPREF0772_11571 (dgkA)
    TW20:
    SATW20_15650
    USA300_TCH1516:
    USA300HOU_1570 (dgkA2)
    VC40:
    SAVC_07095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
    N315            MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
    NCTC8325        MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
    Newman          MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
    USA300_FPR3757  MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
                    ************************************************************

    COL             LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
    N315            LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
    NCTC8325        LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
    Newman          LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
    USA300_FPR3757  LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
                    ******************************************************