From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004152000
  • symbol?: ybeY
  • description?: endoribonuclease YbeY

      descriptions from strain specific annotations:

    • endoribonuclease YbeY
    • putative metalloprotease
    • hypothetical protein0054 protein
    • metal-binding protein
    • metal-dependent hydrolase
  • strand?: -
  • coordinates?: 4419185..4419652
  • synteny block?: BlockID0031820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1528
    08BA02176:
    C248_1613
    11819-97:
    MS7_1587
    71193:
    ST398NM01_1635
    ECT-R 2:
    ECTR2_1420
    ED133:
    SAOV_1570
    ED98:
    SAAV_1562
    HO 5096 0412:
    SAEMRSA15_14900
    JH1:
    SaurJH1_1662
    JH9:
    SaurJH9_1628
    JKD6008:
    SAA6008_01540
    JKD6159:
    SAA6159_01505
    LGA251:
    SARLGA251_14760
    M013:
    M013TW_1585
    MRSA252:
    SAR1647
    MSHR1132:
    SAMSHR1132_14100
    MSSA476:
    SAS1508
    Mu3:
    SAHV_1557
    Mu50:
    SAV1570
    MW2:
    MW1522
    RF122:
    SAB1442c
    ST398:
    SAPIG1635
    T0131:
    SAT0131_01666 (ftsH)
    TCH60:
    HMPREF0772_11570
    TW20:
    SATW20_15660
    USA300_TCH1516:
    USA300HOU_1571
    VC40:
    SAVC_07100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFTIDFSDHTGLVKDAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDK
    N315            MFTIDFSDHTGLVKDAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDK
    NCTC8325        MFTIDFSDHTGLVKDAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDK
    Newman          MFTIDFSDHTGLVKDAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDK
    USA300_FPR3757  MFTIDFSDHTGLVKDAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDK
                    ************************************************************

    COL             DKVTDVISFALEEDEPEIDFSGLDIPRVLGDIIICTDVAQEQANNYGHSFERELGFLALH
    N315            DKVTDVISFALEEDEPEIDFSGLDIPRVLGDIIICTDVAQEQANNYGHSFERELGFLALH
    NCTC8325        DKVTDVISFALEEDEPEIDFSGLDIPRVLGDIIICTDVAQEQANNYGHSFERELGFLALH
    Newman          DKVTDVISFALEEDEPEIDFSGLDIPRVLGDIIICTDVAQEQANNYGHSFERELGFLALH
    USA300_FPR3757  DKVTDVISFALEEDEPEIDFSGLDIPRVLGDIIICTDVAQEQANNYGHSFERELGFLALH
                    ************************************************************

    COL             GFLHLLGYDHMTEADEKEMFGRQDTILNAYGLTRD
    N315            GFLHLLGYDHMTEADEKEMFGRQDTILNAYGLTRD
    NCTC8325        GFLHLLGYDHMTEADEKEMFGRQDTILNAYGLTRD
    Newman          GFLHLLGYDHMTEADEKEMFGRQDTILNAYGLTRD
    USA300_FPR3757  GFLHLLGYDHMTEADEKEMFGRQDTILNAYGLTRD
                    ***********************************