From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004157000
  • symbol?:
  • description?: nfeD-like family protein

      descriptions from strain specific annotations:

    • nfeD-like family protein
    • membrane-bound serine protease
    • Nodulation efficiency protein D (NfeD)
    • transporter
    • membrane protein
  • strand?: -
  • coordinates?: 4422640..4423323
  • synteny block?: BlockID0031870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1532
    08BA02176:
    C248_1617
    11819-97:
    MS7_1591
    71193:
    ST398NM01_1640
    ECT-R 2:
    ECTR2_1424
    ED133:
    SAOV_1574
    ED98:
    SAAV_1566
    HO 5096 0412:
    SAEMRSA15_14940
    JH1:
    SaurJH1_1666
    JH9:
    SaurJH9_1632
    JKD6008:
    SAA6008_01544
    JKD6159:
    SAA6159_01509
    LGA251:
    SARLGA251_14800
    M013:
    M013TW_1589
    MRSA252:
    SAR1651
    MSHR1132:
    SAMSHR1132_14140
    MSSA476:
    SAS1512
    Mu3:
    SAHV_1561
    Mu50:
    SAV1574
    MW2:
    MW1526
    RF122:
    SAB1446c
    ST398:
    SAPIG1640
    T0131:
    SAT0131_01670 (folB)
    TCH60:
    HMPREF0772_11566
    TW20:
    SATW20_15700
    USA300_TCH1516:
    USA300HOU_1575
    VC40:
    SAVC_07120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSYNNFLQMTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGI
    N315            MSYNNFLQMTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGI
    NCTC8325        --------MTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGI
    Newman          MSYNNFLQMTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGI
    USA300_FPR3757  --------MTTILESTAGDTWVEQVSNIIVQPIFTLILTCLTFLGFVYQLYSKKINAAGI
                            ****************************************************

    COL             IATLSLLILFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITISITTL
    N315            IATLSLLILFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITINITTL
    NCTC8325        IATLSLLILFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITISITTL
    Newman          IATLSLLILFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITISITTL
    USA300_FPR3757  IATLSLLILFLGFLIQGNVNMHSILIFSIGVILVVIELFVVGAVIGIIGMILITISITTL
                    *******************************************************.****

    COL             GDNLLFMLANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHL
    N315            GDNLLFMLANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHL
    NCTC8325        GDNLLFMLANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHL
    Newman          GDNLLFMLANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHL
    USA300_FPR3757  GDNLLFMLANVIVALILTIVEWVILVKIFNRKIPFLDKVILKDSTNSESGYNSHDNRSHL
                    ************************************************************

    COL             VGKTAQTVTDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
    N315            VGKTAQTVTDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
    NCTC8325        VGKTAQTVTDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
    Newman          VGKTAQTVTDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
    USA300_FPR3757  VGKTAQTVTDLRPAGIIFCENERIDAVSDGNFILRNKTVKILEVEGTRVVVREVD
                    *******************************************************