From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004161000
  • symbol?: prmA
  • description?: 50S ribosomal protein L11 methyltransferase

      descriptions from strain specific annotations:

    • 50S ribosomal protein L11 methyltransferase
    • ribosomal protein L11 methyltransferase
    • putative methyltransferase
    • putative ribosomal protein L11 methyltransferase
  • strand?: -
  • coordinates?: 4426241..4427179
  • synteny block?: BlockID0031910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1635 (prmA)
    N315:
    SA1407 (prmA)
    NCTC8325:
    Newman:
    NWMN_1481 (prmA)
    USA300_FPR3757:
    04-02981:
    SA2981_1536
    08BA02176:
    C248_1621 (prmA)
    11819-97:
    MS7_1595 (prmA)
    71193:
    ST398NM01_1644
    ECT-R 2:
    ECTR2_1428 (prmA)
    ED133:
    SAOV_1578
    ED98:
    SAAV_1570 (prmA)
    HO 5096 0412:
    SAEMRSA15_14980
    JH1:
    SaurJH1_1670 (prmA)
    JH9:
    SaurJH9_1636 (prmA)
    JKD6008:
    SAA6008_01548 (prmA)
    JKD6159:
    SAA6159_01513 (prmA)
    LGA251:
    SARLGA251_14840
    M013:
    M013TW_1593
    MRSA252:
    SAR1655 (prmA)
    MSHR1132:
    SAMSHR1132_14180
    MSSA476:
    SAS1516 (prmA)
    Mu3:
    SAHV_1565 (prmA)
    Mu50:
    SAV1578 (prmA)
    MW2:
    MW1530 (prmA)
    RF122:
    SAB1450c (prmA)
    ST398:
    SAPIG1644 (prmA)
    T0131:
    SAT0131_01674
    TCH60:
    HMPREF0772_11562 (prmA)
    TW20:
    SATW20_15740
    USA300_TCH1516:
    USA300HOU_1579 (prmA)
    VC40:
    SAVC_07140 (prmA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDGLINQPEDKYGEIYALKKEDYPDK
    N315            MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDK
    NCTC8325        MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDK
    Newman          MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDK
    USA300_FPR3757  MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDK
                    ************************************.***********************

    COL             GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFR
    N315            GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNIQFSEQIIAETDWENEWKNYFHPFR
    NCTC8325        GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFR
    Newman          GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFR
    USA300_FPR3757  GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFR
                    ***********************************:************************

    COL             ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
    N315            ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
    NCTC8325        ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
    Newman          ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
    USA300_FPR3757  ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
                    ************************************************************

    COL             GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
    N315            GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
    NCTC8325        GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
    Newman          GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
    USA300_FPR3757  GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
                    ************************************************************

    COL             DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
    N315            DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
    NCTC8325        DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
    Newman          DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
    USA300_FPR3757  DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
                    ************************************************************

    COL             GWVCLVGQKVSE
    N315            GWVCLVGQKVSE
    NCTC8325        GWVCLVGQKVSE
    Newman          GWVCLVGQKVSE
    USA300_FPR3757  GWVCLVGQKVSE
                    ************