From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004166000
  • symbol?: hemN
  • description?: coproporphyrinogen III oxidase

      descriptions from strain specific annotations:

    • coproporphyrinogen III oxidase
    • Putative coproporphyrinogen III oxidase of BS HemN-type, oxygen-independent, in heat shock gene cluster
    • oxygen-independent coproporphyrinogen III oxidase 1 (Coproporphyrinogenase) (Coprogen oxidase)
    • radical SAM superfamily protein
    • putative oxygen-independent coproporphyrinogenIII oxidase
    • coproporphyrinogen oxidase
    • Oxygen-independent coproporphyrinogen-III oxidase
    • putative coproporphyrinogen III oxidase
    • oxygen-independent coproporphyrinogen oxidase III
  • strand?: -
  • coordinates?: 4432103..4433068
  • synteny block?: BlockID0031960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1412 (hemN)
    NCTC8325:
    Newman:
    NWMN_1486 (hemN)
    USA300_FPR3757:
    04-02981:
    SA2981_1541 (hemN)
    08BA02176:
    C248_1626
    11819-97:
    MS7_1600
    71193:
    ST398NM01_1649
    ECT-R 2:
    ECTR2_1433
    ED133:
    SAOV_1583
    ED98:
    SAAV_1575
    HO 5096 0412:
    SAEMRSA15_15030
    JH1:
    SaurJH1_1675
    JH9:
    SaurJH9_1641
    JKD6008:
    SAA6008_01553 (hemN)
    JKD6159:
    SAA6159_01518 (hemN)
    LGA251:
    SARLGA251_14890
    M013:
    M013TW_1598
    MRSA252:
    SAR1660
    MSHR1132:
    SAMSHR1132_14230
    MSSA476:
    SAS1521
    Mu3:
    SAHV_1570 (hemN)
    Mu50:
    SAV1583 (hemN)
    MW2:
    MW1535 (hemN)
    RF122:
    SAB1455c
    ST398:
    SAPIG1649
    T0131:
    SAT0131_01679 (nupC)
    TCH60:
    HMPREF0772_11557 (hemN)
    TW20:
    SATW20_15790
    USA300_TCH1516:
    USA300HOU_1584 (hemN)
    VC40:
    SAVC_07170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDKKSEKRGIKMTVQSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLDALITEMSTAKYR
    N315            -----------MTVQSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLDALITEMSTAKYR
    NCTC8325        -----------MTVQSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLDALITEMSTAKYR
    Newman          -----------MTVQSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLDALITEMSTAKYR
    USA300_FPR3757  -----------MTVQSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLDALITEMSTAKYR
                               *************************************************

    COL             ILKTMYVGGGTPTALSINQLERLLKAIRDTFTITGEYTFEANPDELTKEKVQLLEKYGVK
    N315            NLKTMYVGGGTPTALSINQLERLLKAIRDTFTITGEYTFEANPDELTKEKVQLLEKYGVN
    NCTC8325        ILKTMYVGGGTPTALSINQLERLLKAIRDTFTITGEYTFEANPDELTKEKVQLLEKYGVK
    Newman          ILKTMYVGGGTPTALSINQLERLLKAIRDTFTITGEYTFEANPDELTKEKVQLLEKYGVK
    USA300_FPR3757  ILKTMYVGGGTPTALSINQLERLLKAIRDTFTITGEYTFEANPDELTKEKVQLLEKYGVK
                     **********************************************************:

    COL             RISMGVQTFKPELLSVLGRTHNTEDIYTSVLNAKNAGIKSISLDLMYHLPKQTIEDFEQS
    N315            RISMGVQTFKPELLSVLGRTHNTEDIYTSVLNAKNAGIKSISLDLMYHLPKQTIEDFEQS
    NCTC8325        RISMGVQTFKPELLSVLGRTHNTEDIYTSVLNAKNAGIKSISLDLMYHLPKQTIEDFEQS
    Newman          RISMGVQTFKPELLSVLGRTHNTEDIYTSVLNAKNAGIKSISLDLMYHLPKQTIEDFEQS
    USA300_FPR3757  RISMGVQTFKPELLSVLGRTHNTEDIYTSVLNAKNTGIKSISLDLMYHLPKQTIEDFEQS
                    ***********************************:************************

    COL             LDLALDMDIQHISSYGLILEPKTQFYNMYRKGLLKLPNEDLGADMYQLLMSKIEQSPFHQ
    N315            LDLALDMDIQHISSYGLILEPKTQFYNMYRKGLLKLPNEDLGADMYQLLMSKIEQSPFHQ
    NCTC8325        LDLALDMDIQHISSYGLILEPKTQFYNMYRKGLLKLANEDLGADMYQLLMSKIEQSPFHQ
    Newman          LDLALDMDIQHISSYGLILEPKTQFYNMYRKGLLKLPNEDLGADMYQLLMSKIEQSPFHQ
    USA300_FPR3757  LDLALDMDIQHISSYGLILEPKTQFYNMYRKGLLKLPNEDLGADMYQLLMSKIEQSPFHQ
                    ************************************.***********************

    COL             YEISNFALDGHESEHNKVYWFNEEYYGFGAGASGYVDGVRYTNINPVNHYIKAINKESKA
    N315            YEISNFALDGHESEHNKVYWFNEEYYGFGAGASGYVDGVRYTNINPVNHYIKAINKESKA
    NCTC8325        YEISNFALDGHESEHNKVYWFNEEYYGFGAGASGYVDGVRYTNINPVNHYIKAINKESKA
    Newman          YEISNFALDGHESEHNKVYWFNEEYYGFGAGASGYVDGVRYTNINPVNHYIKAINKESKA
    USA300_FPR3757  YEISNFALDGHESEHNKVYWFNEEYYGFGAGASGYVDGVRYTNINPVNHYIKAINKESKA
                    ************************************************************

    COL             ILVSNKPSLTERMEEEMFLGLRLNEGVSSSRFKKKFDQSIESVFGQTINNLKEKELIVEK
    N315            ILVSNKPSLTERMEEEMFLGLRLNEGVSSSRFKKKFDQSIESVFGQTINNLKEKELIVEK
    NCTC8325        ILVSNKPSLTERMEEEMFLGLRLNEGVSSSRFKKKFDQSIESVFGQTINNLKEKELIVEK
    Newman          ILVSNKPSLTERMEEEMFLGLRLNEGVSSSRFKKKFDQSIESVFGQTINNLKEKELIVEK
    USA300_FPR3757  ILVSNKPSLTERMEEEMFLGLRLNEGVSSSRFKKKFDQSIESVFGQTINNLKEKELIVEK
                    ************************************************************

    COL             NDVIALTNRGKVIGNEVFEAFLIND
    N315            NDAIALTKRGKVIGNEVFEAFLIND
    NCTC8325        NDVIALTNRGKVIGNEVFEAFLIND
    Newman          NDVIALTNRGKVIGNEVFEAFLIND
    USA300_FPR3757  NDVIALTNRGKVIGNEVFEAFLIND
                    **.****:*****************