From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan004179000
  • symbol?:
  • description?: hydrolase

      descriptions from strain specific annotations:

    • hydrolase
    • metal-dependent phosphohydrolase
    • HD domain-containing protein
    • metal-dependent phosphohydrolase HD domain protein
    • Hydrolase (HAD superfamily), YqeK
    • putative metal dependent phosphohydrolase
  • strand?: -
  • coordinates?: 4442425..4443009
  • synteny block?: BlockID0032090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1551 (yqeK)
    08BA02176:
    C248_1635
    11819-97:
    MS7_1610
    71193:
    ST398NM01_1658
    ECT-R 2:
    ECTR2_1442
    ED133:
    SAOV_1592
    ED98:
    SAAV_1584
    HO 5096 0412:
    SAEMRSA15_15120
    JH1:
    SaurJH1_1685
    JH9:
    SaurJH9_1650
    JKD6008:
    SAA6008_01563
    JKD6159:
    SAA6159_01528
    LGA251:
    SARLGA251_14980
    M013:
    M013TW_1607
    MRSA252:
    SAR1670
    MSHR1132:
    SAMSHR1132_14320
    MSSA476:
    SAS1530
    Mu3:
    SAHV_1580
    Mu50:
    SAV1593
    MW2:
    MW1544
    RF122:
    SAB1465c
    ST398:
    SAPIG1658
    T0131:
    SAT0131_01688 (cysE)
    TCH60:
    HMPREF0772_11548
    TW20:
    SATW20_15890
    USA300_TCH1516:
    USA300HOU_1594
    VC40:
    SAVC_07220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIEKAKRLAKEKLPEKRYNHSLRVAETAIKLAEIYDGDTSKVELAGVLHDFCKYDDLGK
    N315            MNIEKAKRLAKEKLPEKRYNHSLRVAETAIKLAEIYDGDTSKVELAGVLHDFCKYDDLGK
    NCTC8325        MNIEKAKRLAKEKLPEKRYNHSLRVAETAIKLAEIYDGDTSKVELAGVLHDFCKYDDLGK
    Newman          MNIEKAKRLAKEKLPEKRYNHSLRVAETAIKLAEIYDGDTSKVELAGVLHDFCKYDDLGK
    USA300_FPR3757  MNIEKAKRLAKEKLPEKRYNHSLRVAETAIKLAEIYDGDTSKVELAGVLHDFCKYDDLGK
                    ************************************************************

    COL             MYQIVRQYELGNDLLSYGSEILHGPVCAAIMEHEYGINDEEVLMAIKYHTTGRQQMTKTE
    N315            MYQIVRQYELGNDLLSYGSEILHGPVCAAIMEHEYGINDEEVLMAIKYHTTGRQQMTKTE
    NCTC8325        MYQIVRQYELGNDLLSYGSEILHGPVCAAIMEHEYGINDEEVLMAIKYHTTGRQQMTKTE
    Newman          MYQIVRQYELGNDLLSYGSEILHGPVCAAIMEHEYGINDEEVLMAIKYHTTGRQQMTKTE
    USA300_FPR3757  MYQIVRQYELGNDLLSYGSEILHGPVCAAIMEHEYGINDEEVLMAIKYHTTGRQQMTKTE
                    ************************************************************

    COL             KLIFIADYIEPGRTIPGVDDIRDMAYNQGSLDKTIYEISKRTVLFLIQKDITVYNKTIDC
    N315            KLIFIADYIEPGRTIPGVDDIRDMAYNQGSLDKTIYEISKRTVLFLIQKDITVYNKTIDC
    NCTC8325        KLIFIADYIEPGRTIPGVDDIRDMAYNQGSLDKTIYEISKRTVLFLIQKDITVYNKTIDC
    Newman          KLIFIADYIEPGRTIPGVDDIRDMAYNQGSLDKTIYEISKRTVLFLIQKDITVYNKTIDC
    USA300_FPR3757  KLIFIADYIEPGRTIPGVDDIRDMAYNQGSLDKTIYEISKRTVLFLIQKDITVYNKTIDC
                    ************************************************************

    COL             LNYYNYSDERIKDD
    N315            LNYYNYSDERIKDD
    NCTC8325        LNYYNYSDERIKDD
    Newman          LNYYNYSDERIKDD
    USA300_FPR3757  LNYYNYSDERIKDD
                    **************