From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004181000
  • symbol?:
  • description?: RNA binding protein

      descriptions from strain specific annotations:

    • RNA binding protein
    • CRS1 / YhbY domain protein
    • RNA-binding protein YbhY
    • RNA binding protein (CRS1/YhbY family)
  • strand?: -
  • coordinates?: 4443571..4443861
  • synteny block?: BlockID0032110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1553
    08BA02176:
    C248_1637
    11819-97:
    MS7_1612
    71193:
    ST398NM01_1660
    ECT-R 2:
    ECTR2_1444
    ED133:
    SAOV_1594
    ED98:
    SAAV_1586
    HO 5096 0412:
    SAEMRSA15_15140
    JH1:
    SaurJH1_1687
    JH9:
    SaurJH9_1652
    JKD6008:
    SAA6008_01565 (yhbY)
    JKD6159:
    SAA6159_01530 (yhbY)
    LGA251:
    SARLGA251_15000
    M013:
    M013TW_1609
    MRSA252:
    SAR1672
    MSHR1132:
    SAMSHR1132_14340
    MSSA476:
    SAS1532
    Mu3:
    SAHV_1582
    Mu50:
    SAV1595
    MW2:
    MW1546
    RF122:
    SAB1467c
    ST398:
    SAPIG1660
    T0131:
    SAT0131_01690
    TCH60:
    HMPREF0772_11546
    TW20:
    SATW20_15910
    USA300_TCH1516:
    USA300HOU_1596
    VC40:
    SAVC_07230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKE
    N315            MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKE
    NCTC8325        MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKE
    Newman          MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKE
    USA300_FPR3757  MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKE
                    ************************************************************

    COL             LAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP
    N315            LAETLSEATRSELVQVIGSMIVIYRESKENKEIELP
    NCTC8325        LAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP
    Newman          LAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP
    USA300_FPR3757  LAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP
                    *********:******************:*******