From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004187000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 4447357..4447626
  • synteny block?: BlockID0032170
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1558
    08BA02176:
    C248_1642
    11819-97:
    MS7_1617
    71193:
    ST398NM01_1665
    ECT-R 2:
    ECTR2_1449
    ED133:
    SAOV_1599
    ED98:
    SAAV_1591
    HO 5096 0412:
    SAEMRSA15_15190
    JH1:
    SaurJH1_1692
    JH9:
    SaurJH9_1657
    JKD6008:
    SAA6008_01571
    JKD6159:
    SAA6159_01535
    LGA251:
    M013:
    M013TW_1614
    MRSA252:
    SAR1677
    MSHR1132:
    SAMSHR1132_14390
    MSSA476:
    SAS1537
    Mu3:
    SAHV_1587
    Mu50:
    SAV1600
    MW2:
    MW1551
    RF122:
    SAB1472
    ST398:
    SAPIG1665
    T0131:
    SAT0131_01697
    TCH60:
    HMPREF0772_11541
    TW20:
    USA300_TCH1516:
    USA300HOU_1602
    VC40:
    SAVC_07255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAENNQNSLVTKIATYGSFIAIASFVILFISIFLKFSFNIEFTATIMNICRYTLILGFIL
    N315            MAENNQNSLVTKIATYGSFIAIASFVILFISIFLKFSFNIEFIATIMNICRYTLILGFIL
    NCTC8325        MAENNQNSLVTKIATYGSFIAIASFVILFISIFLKFSFNIEFTATIMNICRYTLILGFIL
    Newman          MAENNQNSLVTKIATYGSFIAIASFVILFISIFLKFSFNIEFTATIMNICRYTLILGFIL
                    ****************************************** *****************

    COL             MSLPDVVDKNIKKIIFDAFIIIVFIFFLL
    N315            MSLPDVVDKNIKKIIFDAFIIIVFIFFLL
    NCTC8325        MSLPDVVDKNIKKIIFDAFIIIVFIFFLL
    Newman          MSLPDVVDKNIKKIIFDAFIIIVFIFFLL
                    *****************************