From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004191000
  • symbol?:
  • description?: enterotoxin type A

      descriptions from strain specific annotations:

    • enterotoxin type A
    • putative enterotoxin type A
    • enterotoxin family protein
    • Enterotoxin
    • pseudogene
    • staphylococcal/Streptococcal toxin, OB-fold domain protein
    • toxin OB-fold domain-containing protein
  • strand?: -
  • coordinates?: 4448573..4449264
  • synteny block?: BlockID0032210
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1560
    08BA02176:
    11819-97:
    MS7_1618 (entA)
    71193:
    ECT-R 2:
    ECTR2_1451
    ED133:
    ED98:
    SAAV_1593
    HO 5096 0412:
    JH1:
    SaurJH1_1693
    JH9:
    SaurJH9_1659
    JKD6008:
    SAA6008_01572
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1538
    Mu3:
    SAHV_1589
    Mu50:
    SAV1602
    MW2:
    MW1552
    RF122:
    ST398:
    T0131:
    SAT0131_01698 (rplK)
    TCH60:
    TW20:
    SATW20_15960
    USA300_TCH1516:
    USA300HOU_1603
    VC40:
    SAVC_07260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------------------------MLEGIFTNSASAIEYSDLHHKSKFD
    N315            MSQPVYHLCLALKCKLIIVLGEFEVKYLTGFILILLLEGIFTNSASAIEYSDLHHKSKFD
    NCTC8325        -----------------------------------MLEGIFTNSASAIEYSDLHHKSKFD
    Newman          -----------------------------------MLEGIFTNSASAIEYSDLHHKSKFD
    USA300_FPR3757  -----------------------------------MLEGIFTNSASAIEYSDLHHKSKFD
                                                       :************************

    COL             SKRLSNAKMSFINPTQLENKNTNDRLLKHDLLFHDMFVNDDWKKDFKVEFENEALSKKFI
    N315            SKRLSNAKMSFINPTQLENKNTNDRLLKHDLLFHDMFVNVASKKDFKVEFENEALSKKFI
    NCTC8325        SKRLSNAKMSFINPTQLENKNTNDRLLKHDLLFHDMFVNDDWKKDFKVEFENEALSKKFI
    Newman          SKRLSNAKMSFINPTQLENKNTNDRLLKHDLLFHDMFVNDDWKKDFKVEFENEALSKKFI
    USA300_FPR3757  SKRLSNAKMSFINPTQLENKNTNDRLLKHDLLFHDMFVNDDWKKDFKVEFENEALSKKFI
                    ***************************************   ******************

    COL             NKDIDIFAGNYGYGCHGGATNKTQCSYGGVTLSDNNKYDDYKNIPCNLWIDGHQTEIELT
    N315            NKNIDIYAGSYSYECHGGATNKTQCSYGGVTLSDNNK-----------------------
    NCTC8325        NKDIDIFAGNYGYGCHGGATNKTQCSYGGVTLSDNNKYDDYKNIPCNLWIDGHQTEIELT
    Newman          NKDIDIFAGNYGYGCHGGATNKTQCSYGGVTLSDNNKYDDYKNIPCNLWIDGHQTEIELT
    USA300_FPR3757  NKDIDIFAGNYGYGCHGGATNKTQCSYGGVTLSDNNKYDDYKNIPCNLWIDGHQTEIELT
                    **:***:**.*.* ***********************                       

    COL             AVKTKKKIVTIQELEVQLRNYLNEKYKLYEQGGDIVKGYVKYYNDDEQNVEYDFYNLNGE
    N315            ------------------------------------------------------------
    NCTC8325        AVKTKKKIVTIQELEVQLRNYLNEKYKLYEQGGDIVKGYVKYYNDDEQNVEYDFYNLNGE
    Newman          AVKTKKKIVTIQELEVQLRNYLNEKYKLYEQGGDIVKGYVKYYNDDEQNVEYDFYNLNGE
    USA300_FPR3757  AVKTKKKIVTIQELEVQLRNYLNEKYKLYEQGGDIVKGYVKYYNDDEQNVEYDFYNLNGE
                                                                                

    COL             YGREVLKMYADNKTINSDKLHLDIYLFKS
    N315            -----------------------------
    NCTC8325        YGREVLKMYADNKTINSDKLHLDIYLFKS
    Newman          YGREVLKMYADNKTINSDKLHLDIYLFKS
    USA300_FPR3757  YGREVLKMYADNKTINSDKLHLDIYLFKS