From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004195000
  • symbol?:
  • description?: fic family protein

      descriptions from strain specific annotations:

    • fic family protein
    • fic/DOC family protein
    • Fic protein family
    • phage protein
    • pseudogene
  • strand?: -
  • coordinates?: 4450648..4453201
  • synteny block?: BlockID0032250
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1561
    08BA02176:
    C248_1645
    11819-97:
    MS7_1619
    71193:
    ST398NM01_1667
    ECT-R 2:
    ECTR2_1452
    ED133:
    SAOV_1601
    ED98:
    SAAV_1594
    HO 5096 0412:
    SAEMRSA15_15210
    JH1:
    SaurJH1_1694
    JH9:
    SaurJH9_1660
    JKD6008:
    SAA6008_01573
    JKD6159:
    LGA251:
    SARLGA251_15060
    M013:
    M013TW_1619
    MRSA252:
    SAR1682
    MSHR1132:
    SAMSHR1132_14400
    MSSA476:
    SAS1539
    Mu3:
    SAHV_1590
    Mu50:
    SAV1603
    MW2:
    MW1553
    RF122:
    SAB1474c
    ST398:
    SAPIG1667
    T0131:
    SAT0131_01699 (rplA)
    TCH60:
    HMPREF0772_11538
    TW20:
    USA300_TCH1516:
    USA300HOU_1604
    VC40:
    SAVC_07265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGYRTLKSIFHEHNESKMKEEYIKRFNSLASFNTNINIIPMENGKKVNDLEYPLFFMVTK
    N315            MGYRTLKSIFHEHNESKMKEEYTKRFNSLASFNTNINIIPMENGKKVNDLEYPLFFMVTK
    NCTC8325        MGYRTLKSIFHEHNESKMKEEYIKRFNSLASFNTNINIIPMENGKKVNDLEYPLFFMVTK
    Newman          MGYRTLKSIFHEHNESKMKEEYIKRFNSLASFNTNINIIPMENGKKVNDLEYPLFFMVTK
    USA300_FPR3757  MGYRTLKSIFHEHNESKMKEEYIKRFNSLASFNTNINIIPMENGKKVNDLEYPLFFMVTK
                    ********************** *************************************

    COL             NLSKKQELISINSRKIDRALNSLPYAAREQYFNDLLIDELQSTNEIENVFSTKQEIAHAL
    N315            NLSKKQELISINSRKIDRALNSLPYAAREQYFNDLLIDELQSTNEIENVFSTKQEIAHAL
    NCTC8325        NLSKKQELISINSRKIDRALNSLPYAAREQYFNDLLIDELQSTNEIENVFSTKQEIAHAL
    Newman          NLSKKQELISINSRKIDRALNSLPYAAREQYFNDLLIDELQSTNEIENVFSTKQEIAHAL
    USA300_FPR3757  NLSKKQELISINSRKIDRALNSLPYAAREQYFNDLLIDELQSTNEIENVFSTKQEIAHAL
                    ************************************************************

    COL             NNQASEFLKFRGLVDQYKEIELNKKIKVDNVRDIRAIYDKLVSNEINEQDKLDGELFRKN
    N315            NNQASEFLKFRGLVDQYKEIELNKKIKVDNVRDIRAIYDKLVSNEINEQDKLDGELFRKN
    NCTC8325        NNQASEFLKFRGLVDQYKEIELNKKIKVDNVRDIRAIYDKLVSNEINEQDKLDGELFRKN
    Newman          NNQASEFLKFRGLVDQYKEIELNKKIKVDNVRDIRAIYDKLVSNEINEQDKLDGELFRKN
    USA300_FPR3757  NNQASEFLKFRGLVDQYKEIELNKKIKVDNVRDIRAIYDKLVSNEINEQDKLDGELFRKN
                    ************************************************************

    COL             FVGVHDGSTNKYIHVGLQPETKIVEFIGEMLTFLKYFDAPQPFKIMASHYLFEYIHPFYD
    N315            FVGVHDGSTNKYIHVGLQPETKIVEYIGEMLTFLKYFDAPQPFKIMASHYLFEYIHPFYD
    NCTC8325        FVGVHDGSTNKYIHVGLQPETKIVEFIGEMLTFLKYFDAPQPFKIMASHYLFEYIHPFYD
    Newman          FVGVHDGSTNKYIHVGLQPETKIVEFIGEMLTFLKYFDAPQPFKIMASHYLFEYIHPFYD
    USA300_FPR3757  FVGVHDGSTNKYIHVGLQPETKIVEFIGEMLTFLKYFDAPQPFKIMASHYLFEYIHPFYD
                    *************************:**********************************

    COL             GNGRVGRFIIAKLLSDYYDNYTALTFSYVINRNKSKYYKAFMTASNHLNCGDLTEFIDTM
    N315            GNGRVGRFIIAKLLSDYYDNYTALTFSYVINRNKSKYYKAFMTASNHLNCGDLTEFIDTM
    NCTC8325        GNGRVGRFIIAKLLSDYYDNYTALTFSYVINRNKSKYYKAFMTASNHLNCGDLTEFIDTM
    Newman          GNGRVGRFIIAKLLSDYYDNYTALTFSYVINRNKSKYYKAFMTASNHLNCGDLTEFIDTM
    USA300_FPR3757  GNGRVGRFIIAKLLSDYYDNYTALTFSYVINRNKSKYYKAFMTASNHLNCGDLTEFIDTM
                    ************************************************************

    COL             LELLIAGQERILDELIPKMDATEKLTLYLTSHYKQIDYEFLYLLSMDKLFGNKRNRLTLI
    N315            LELLIAGQERILDELIPKMDATEKLTLYLTSHYKQIDYEFLYLLSMDKLFGNKRNRLTLI
    NCTC8325        LELLIAGQERILDELIPKMDATEKLTLYLTSHYKQIDYEFLYLLSMDKLFGNKRNRLTLI
    Newman          LELLIAGQERILDELIPKMDATEKLTLYLTSHYKQIDYEFLYLLSMDKLFGNKRNRLTLI
    USA300_FPR3757  LELLIAGQERILDELIPKMDATEKLTLYLTSHYKQIDYEFLYLLSMDKLFGNKRNRLTLI
                    ************************************************************

    COL             DLENILGVGRVKINNTIKKYDNYLVKIKSRPTIYEISDEFLNSIIK
    N315            DLENILGVGRVKINNTIKKYDNYLVKIKSRPTIYEISDEFLNSIIK
    NCTC8325        DLENILGVGRVKINNTIKKYDNYLVKIKSRPTIYEISDEFLNSIIK
    Newman          DLENILGVGRVKINNTIKKYDNYLVKIKSRPTIYEISDEFLNSIIK
    USA300_FPR3757  DLENILGVGRVKINNTIKKYDNYLVKIKSRPTIYEISDEFLNSIIK
                    **********************************************