From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan004199000
  • symbol?:
  • description?: LamB/YcsF family protein

      descriptions from strain specific annotations:

    • LamB/YcsF family protein
    • Lactam utilization protein LAMB
    • protein BLi00498/
    • lactam utilisation protein
  • strand?: -
  • coordinates?: 4454750..4455502
  • synteny block?: BlockID0032280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1563
    08BA02176:
    C248_1647
    11819-97:
    MS7_1621
    71193:
    ST398NM01_1669
    ECT-R 2:
    ECTR2_1454
    ED133:
    SAOV_1603
    ED98:
    SAAV_1597
    HO 5096 0412:
    SAEMRSA15_15230
    JH1:
    SaurJH1_1696
    JH9:
    SaurJH9_1662
    JKD6008:
    SAA6008_01575 (lamB)
    JKD6159:
    SAA6159_01538 (lamB)
    LGA251:
    SARLGA251_15080
    M013:
    M013TW_1621
    MRSA252:
    SAR1684
    MSHR1132:
    SAMSHR1132_14420
    MSSA476:
    SAS1541
    Mu3:
    SAHV_1592
    Mu50:
    SAV1605
    MW2:
    MW1555
    RF122:
    SAB1476c
    ST398:
    SAPIG1669
    T0131:
    SAT0131_01701 (rplL)
    TCH60:
    HMPREF0772_11536
    TW20:
    SATW20_16000
    USA300_TCH1516:
    USA300HOU_1605
    VC40:
    SAVC_07275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVDLNCDLGEAFGNYSFGGDHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVG
    N315            MRVDLNCDLGEAFGNYSFGGDHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVG
    NCTC8325        MRVDLNCDLGEAFGNYSFGGDHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVG
    Newman          MRVDLNCDLGEAFGNYSFGGDHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVG
    USA300_FPR3757  MRVDLNCDLGEAFGNYSFGGDHQIIPLITSANVACGFHAGDENVMNETVKLAKAHNVAVG
                    ************************************************************

    COL             AHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQVKINHVKPHGALYQMGAK
    N315            AHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQLKINHVKPHGALYQMGAK
    NCTC8325        AHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQVKINHVKPHGALYQMGAK
    Newman          AHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQVKINHVKPHGALYQMGAK
    USA300_FPR3757  AHPGLPDLKGFGRRNIDISNDEIYNLMIYQLGALQGFCRIHQVKINHVKPHGALYQMGAK
                    ******************************************:*****************

    COL             DREIANVIAQAVYDFDPSLVLVGLANSYLISEAKNVGLITASEVFADRRYEDDGQLVSRK
    N315            DREIANVIAQAVYDFDPSLVLVGLANSYLISEAKNVGLITASEVFADRRYEDDGQLVSRK
    NCTC8325        DREIANVIAQAVYDFDPSLVLVGLANSYLISEAKNVGLITASEVFADRRYEDDGQLVSRK
    Newman          DREIANVIAQAVYDFDPSLVLVGLANSYLISEAKNVGLITASEVFADRRYEDDGQLVSRK
    USA300_FPR3757  DREIANVIAQAVYDFDPSLVLVGLANSYLISEAKNVGLITASEVFADRRYEDDGQLVSRK
                    ************************************************************

    COL             ESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREIL
    N315            ESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREIL
    NCTC8325        ESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREIL
    Newman          ESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREIL
    USA300_FPR3757  ESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICVHGDGEHALLFVSKIREIL
                    ************************************************************

    COL             MKEGIDIQSL
    N315            MKEGIDIQSL
    NCTC8325        MKEGIDIQSL
    Newman          MKEGIDIQSL
    USA300_FPR3757  MKEGIDIQSL
                    **********