From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004203000
  • symbol?:
  • description?: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

      descriptions from strain specific annotations:

    • acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
    • acetyl-CoA carboxylase, biotin carboxyl carrier protein
    • putative biotin carboxyl carrier protein ofacetyl-CoA carboxylase
    • acetyl-CoA carboxylase
    • acetyl-CoA carboxylase, biotin carboxyl carrier protein, putative
    • acetyl-CoA carboxylase biotin carboxyl carrier protein subunit, Acc_B1
    • acetyl-CoA carboxylase biotin carboxyl carrier subunit
    • biotin/lipoyl attachment domain-containing protein
    • Biotin carboxyl carrier protein
    • biotin carboxyl carrier protein of acetyl-CoA carboxylase
    • biotin-requiring enzyme family protein
  • strand?: -
  • coordinates?: 4456877..4457336
  • synteny block?: BlockID0032310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1508 (accB)
    USA300_FPR3757:
    04-02981:
    SA2981_1565 (accB)
    08BA02176:
    C248_1649
    11819-97:
    MS7_1623
    71193:
    ST398NM01_1671
    ECT-R 2:
    ECTR2_1456
    ED133:
    SAOV_1605 (accB_1)
    ED98:
    SAAV_1599
    HO 5096 0412:
    SAEMRSA15_15250
    JH1:
    SaurJH1_1698
    JH9:
    SaurJH9_1664
    JKD6008:
    SAA6008_01577 (accB_1)
    JKD6159:
    SAA6159_01540 (accB_1)
    LGA251:
    SARLGA251_15100
    M013:
    M013TW_1626
    MRSA252:
    SAR1686
    MSHR1132:
    SAMSHR1132_14440
    MSSA476:
    SAS1543
    Mu3:
    SAHV_1594
    Mu50:
    SAV1607
    MW2:
    MW1557
    RF122:
    SAB1478c (accB)
    ST398:
    SAPIG1671
    T0131:
    SAT0131_01703 (rpoB)
    TCH60:
    HMPREF0772_11534 (accB)
    TW20:
    SATW20_16020
    USA300_TCH1516:
    USA300HOU_1607
    VC40:
    SAVC_07285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDLNHLAAHSNQSNQSMNNNDLTASK
    N315            MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASK
    NCTC8325        MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASK
    Newman          MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASK
    USA300_FPR3757  MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASK
                    ************************************ ***********************

    COL             ANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
    N315            ANDNSDVSTNDYHDIKSPMVGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
    NCTC8325        ANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
    Newman          ANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
    USA300_FPR3757  ANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
                    *******************:****************************************

    COL             TTDVAGEITEIVADHGTNVEYDQVLVRIK
    N315            TTDVAGEITEIVADHGTNVEYDQVLVRIK
    NCTC8325        TTDVAGEITEIVADHGTNVEYDQVLVRIK
    Newman          TTDVAGEITEIVADHGTNVEYDQVLVRIK
    USA300_FPR3757  TTDVAGEITEIVADHGTNVEYDQVLVRIK
                    *****************************