From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004204000
  • symbol?:
  • description?: allophanate hydrolase

      descriptions from strain specific annotations:

    • allophanate hydrolase
    • Allophanate hydrolase subunit 2
    • allophanate hydrolase 2 subunit 2
    • biotin-dependent carboxylase
    • urea carboxylase
    • urea short-chain amide or branched-chain amino acid uptake ABC transporter periplasmic solute-binding protein
  • strand?: -
  • coordinates?: 4457338..4458252
  • synteny block?: BlockID0032320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1566
    08BA02176:
    C248_1650
    11819-97:
    MS7_1624
    71193:
    ST398NM01_1672
    ECT-R 2:
    ECTR2_1457
    ED133:
    SAOV_1606
    ED98:
    SAAV_1600
    HO 5096 0412:
    SAEMRSA15_15260
    JH1:
    SaurJH1_1699
    JH9:
    SaurJH9_1665
    JKD6008:
    SAA6008_01578 (ahs2)
    JKD6159:
    SAA6159_01541 (AHS2)
    LGA251:
    SARLGA251_15110
    M013:
    M013TW_1627
    MRSA252:
    SAR1687
    MSHR1132:
    SAMSHR1132_14450
    MSSA476:
    SAS1544
    Mu3:
    SAHV_1595
    Mu50:
    SAV1608
    MW2:
    MW1558
    RF122:
    SAB1479c
    ST398:
    SAPIG1672
    T0131:
    SAT0131_01704 (rpoC)
    TCH60:
    HMPREF0772_11533
    TW20:
    SATW20_16030
    USA300_TCH1516:
    USA300HOU_1608
    VC40:
    SAVC_07290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIKILQPGLFSTVQDLGRIGYEHIGFSGAGAMDQFSFKVAQSLINNDGPAIEYTLIGPT
    N315            MSIKILQPGLFSTVQDLGRIGYEHIGFSGAGAMDQFSFKVAQSLINNDGPAIEYTLIGPT
    NCTC8325        --------------------------------MDQFSFKVAQSLINNDGPAIEYTLIGPT
    Newman          MSIKILQPGLFSTVQDLGRIGYEHIGFSGAGAMDQFSFKVAQSLINNDGPAIEYTLIGPT
    USA300_FPR3757  --------------------------------MDQFSFKVAQSLINNDGPAIEYTLIGPT
                                                    ****************************

    COL             IQFNTQNTFVITGGSINASLNNKTISMNSVILAEKGDILKIGAITKGARGYLTFGHSINV
    N315            IQFNTQNTFVITGGSINASLNNKTISMNSVILAEKGDILKIGAITKGVRGYLTFGHSINV
    NCTC8325        IQFNTQNTFVITGGSINASLNNKTISMNSVILAEKGDILKIGAITKGARGYLTFGHSINV
    Newman          IQFNTQNTFVITGGSINASLNNKTISMNSVILAEKGDILKIGAITKGARGYLTFGHSINV
    USA300_FPR3757  IQFNTQNTFVITGGSINASLNNKTISMNSVILAEKGDILKIGAITKGARGYLTFGHSINV
                    ***********************************************.************

    COL             PSIAESYATHTRSSIGGFKGRKLLADDVITVKINNDFKENIGKTIHLQDDLLPENNIIHI
    N315            PSIAESYATHTRSSIGGFKGRKLLANDVITVKINNDFKENIGKTIHLQDDLLPENNIIHI
    NCTC8325        PSIAESYATHTRSSIGGFKGRKLLADDVITVKINNDFKENIGKTIHLQDDLLPENNIIHI
    Newman          PSIAESYATHTRSSIGGFKGRKLLADDVITVKINNDFKENIGKTIHLQDDLLPENNIIHI
    USA300_FPR3757  PSIAESYATHTRSSIGGFKGRKLLADDVITVKINNDFKENIGKTIHLQDDLLPENNIIHI
                    *************************:**********************************

    COL             LQGPQFEAFSEEARAKIVNHPYLITEQSDRMGYRLEGDSVAPINQADIISEPVALGSVQV
    N315            LQGPQFEAFSEEARAKIVNHPYLITEQSDRMGYRLEGDSVAPINQADIISEPVALGSVQV
    NCTC8325        LQGPQFEAFSEEARAKIVNHPYLITEQSDRMGYRLEGDSVAPINQADIISEPVALGSVQV
    Newman          LQGPQFEAFSEEARAKIVNHPYLITEQSDRMGYRLEGDSVAPINQADIISEPVALGSVQV
    USA300_FPR3757  LQGPQFEAFSEEARAKIVNHPYLITEQSDRMGYRLEGDSVAPINQADIISEPVALGSVQV
                    ************************************************************

    COL             PNDGQPIILLNDKQTIGGYTKIATVCKFDLPKLAQMKPQDTIQFKWISFQEAVDKNREQM
    N315            PNDGQPIILLNDKQTIGGYTKIATVCKFDLPKLAQMKPKDTIQFKWISFQEAVDKNREQM
    NCTC8325        PNDGQPIILLNDKQTIGGYTKIATVCKFDLPKLAQMKPQDTIQFKWISFQEAVDKNREQM
    Newman          PNDGQPIILLNDKQTIGGYTKIATVCKFDLPKLAQMKPQDTIQFKWISFQEAVDKNREQM
    USA300_FPR3757  PNDGQPIILLNDKQTIGGYTKIATVCKFDLPKLAQMKPQDTIQFKWISFQEAVDKNREQM
                    **************************************:*********************

    COL             SLFNEILKSHQKTPIFDTSSLRHTSKKLATILKGDL
    N315            SLFNEILKSHQKTPIFDTSSLRHTSKKLSTILKGDL
    NCTC8325        SLFNEILKSHQKTPIFDTSSLRHTSKKLATILKGDL
    Newman          SLFNEILKSHQKTPIFDTSSLRHTSKKLATILKGDL
    USA300_FPR3757  SLFNEILKSHQKTPIFDTSSLRHTSKKLATILKGDL
                    ****************************:*******