From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004206000
  • symbol?: greA
  • description?: transcription elongation factor GreA

      descriptions from strain specific annotations:

    • transcription elongation factor GreA
    • transcription elongation factor greA (Transcript cleavage factor greA)(General stress protein 20M) (GSP20M)
  • strand?: -
  • coordinates?: 4459409..4459885
  • synteny block?: BlockID0032340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1665 (greA)
    N315:
    SA1438 (greA)
    NCTC8325:
    Newman:
    NWMN_1511 (greA)
    USA300_FPR3757:
    04-02981:
    SA2981_1568 (greA)
    08BA02176:
    C248_1652 (greA)
    11819-97:
    MS7_1626 (greA)
    71193:
    ST398NM01_1674
    ECT-R 2:
    ECTR2_1459 (greA)
    ED133:
    SAOV_1608 (greA)
    ED98:
    SAAV_1602 (greA)
    HO 5096 0412:
    SAEMRSA15_15280 (greA)
    JH1:
    SaurJH1_1701 (greA)
    JH9:
    SaurJH9_1667 (greA)
    JKD6008:
    SAA6008_01580 (greA)
    JKD6159:
    SAA6159_01543 (greA)
    LGA251:
    SARLGA251_15130 (greA)
    M013:
    M013TW_1629
    MRSA252:
    SAR1689 (greA)
    MSHR1132:
    SAMSHR1132_14470
    MSSA476:
    SAS1546 (greA)
    Mu3:
    SAHV_1597 (greA)
    Mu50:
    SAV1610 (greA)
    MW2:
    MW1560 (greA)
    RF122:
    SAB1481c (greA)
    ST398:
    SAPIG1674
    T0131:
    SAT0131_01707 (rpsL)
    TCH60:
    HMPREF0772_11531 (greA)
    TW20:
    SATW20_16050 (greA)
    USA300_TCH1516:
    USA300HOU_1610 (greA)
    VC40:
    SAVC_07300 (greA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENQKQYPMTQEGFEKLERELEELKTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGF
    N315            MENQKQYPMTQEGFEKLERELEELKTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGF
    NCTC8325        MENQKQYPMTQEGFEKLERELEELKTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGF
    Newman          MENQKQYPMTQEGFEKLERELEELKTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGF
    USA300_FPR3757  MENQKQYPMTQEGFEKLERELEELKTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGF
                    ************************************************************

    COL             IEQDIQRIEHMLRNALIIEDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGK
    N315            IEQDIQRIEHMLRNALIIEDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGK
    NCTC8325        IEQDIQRIEHMLRNALIIEDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGK
    Newman          IEQDIQRIEHMLRNALIIEDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGK
    USA300_FPR3757  IEQDIQRIEHMLRNALIIEDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGK
                    ************************************************************

    COL             ISNESPMAKALIGKGLDDEVRVPLPNGGEMNVKIVNIQ
    N315            ISNESPMAKALIGKGLDDEVRVPLPNGGEMNVKIVNIQ
    NCTC8325        ISNESPMAKALIGKGLDDEVRVPLPNGGEMNVKIVNIQ
    Newman          ISNESPMAKALIGKGLDDEVRVPLPNGGEMNVKIVNIQ
    USA300_FPR3757  ISNESPMAKALIGKGLDDEVRVPLPNGGEMNVKIVNIQ
                    **************************************