From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004211000
  • symbol?:
  • description?: YrzB like protein
  • strand?: -
  • coordinates?: 4463666..4463974
  • synteny block?: BlockID0032390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1573
    08BA02176:
    C248_1657
    11819-97:
    MS7_1631
    71193:
    ST398NM01_1679
    ECT-R 2:
    ECTR2_1464
    ED133:
    SAOV_1613
    ED98:
    SAAV_1607
    HO 5096 0412:
    SAEMRSA15_15330
    JH1:
    SaurJH1_1706
    JH9:
    SaurJH9_1672
    JKD6008:
    SAA6008_01585
    JKD6159:
    SAA6159_01548
    LGA251:
    SARLGA251_15180
    M013:
    M013TW_1634
    MRSA252:
    SAR1694
    MSHR1132:
    SAMSHR1132_14520
    MSSA476:
    SAS1551
    Mu3:
    SAHV_1602
    Mu50:
    SAV1615
    MW2:
    MW1565
    RF122:
    SAB1486c
    ST398:
    SAPIG1679
    T0131:
    SAT0131_01712
    TCH60:
    HMPREF0772_11526
    TW20:
    SATW20_16100
    USA300_TCH1516:
    USA300HOU_1615
    VC40:
    SAVC_07325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDD
    N315            MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDD
    NCTC8325        MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDD
    Newman          MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDD
    USA300_FPR3757  MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDD
                    ************************************************************

    COL             MIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE
    N315            MIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE
    NCTC8325        MIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE
    Newman          MIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE
    USA300_FPR3757  MIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE
                    ******************************************