From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004224000
  • symbol?:
  • description?: flavin dependent oxidoreductase

      descriptions from strain specific annotations:

    • flavin dependent oxidoreductase
    • luciferase family protein
    • Flavin-utilizing monoxygenase
    • luciferase-like monooxygenase family protein
    • dehydrogenase
    • putative oxygenase
    • luciferase family oxidoreductase
    • luciferase oxidoreductase, group 1 family protein
    • Flavin-utilizing monooxygenase
    • luciferase family monooxygenase
    • bacterial luciferase family protein
  • strand?: +
  • coordinates?: 4474362..4475443
  • synteny block?: BlockID0032520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1581
    08BA02176:
    C248_1665
    11819-97:
    MS7_1639
    71193:
    ST398NM01_1687
    ECT-R 2:
    ECTR2_1472
    ED133:
    SAOV_1621
    ED98:
    SAAV_1616
    HO 5096 0412:
    SAEMRSA15_15410
    JH1:
    SaurJH1_1714
    JH9:
    SaurJH9_1681
    JKD6008:
    SAA6008_01593
    JKD6159:
    SAA6159_01556
    LGA251:
    SARLGA251_15260
    M013:
    M013TW_1644
    MRSA252:
    SAR1703
    MSHR1132:
    SAMSHR1132_14600
    MSSA476:
    SAS1559
    Mu3:
    SAHV_1610
    Mu50:
    SAV1623
    MW2:
    MW1573
    RF122:
    SAB1494
    ST398:
    SAPIG1687
    T0131:
    SAT0131_01720
    TCH60:
    HMPREF0772_11518
    TW20:
    SATW20_16180
    USA300_TCH1516:
    USA300HOU_1623
    VC40:
    SAVC_07365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIKYSALNLVPIREGEDEQTAINDMVNLAQHLDELSYERYWIAEHHNAPNLVSSATALL
    N315            MAIKYSALNLVPIREGDDERTAINDMVKLAQHLDELSYERYWIAEHHNAPNLVSSATALL
    NCTC8325        MAIKYSALNLVPIREGEDEQTAINNMVNLAQHLDELSYERYWIAEHHNAPNLVSSATALL
    Newman          MAIKYSALNLVPIREGEDEQTAINDMVNLAQHLDELSYERYWIAEHHNAPNLVSSATALL
    USA300_FPR3757  MAIKYSALNLVPIREGEDEQTAINDMVNLAQHLDELSYERYWIAEHHNAPNLVSSATALL
                    ****************:**:****:**:********************************

    COL             IQHTLEHTKHIRVGSGGIMLPNHAPLIVAEQFGTMATLFPNRVDLGLGRAPGTDMMTASA
    N315            IQHTLEHTKHIRVGSGGIMLPNHAPLIVAEQFGTMATLFPNRVDLGLGRAPGTDMMTASA
    NCTC8325        IQHTLEHTKHIRVGSGGIMLPNHAPLIVAEQFGTMATLFPNRVDLGLGRAPGTDMMTASA
    Newman          IQHTLEHTKHIRVGSGGIMLPNHAPLIVAEQFGTMATLFPNRVDLGLGRAPGTDMMTASA
    USA300_FPR3757  IQHTLEHTKHIRVGSGGIMLPNHAPLIVAEQFGTMATLFPNRVDLGLGRAPGTDMMTASA
                    ************************************************************

    COL             LRRDQHDGVYKFPEEVSLLQQYFGPAHQQAYVRAYPAVGKNVPLYILGSSTDSAHLAARK
    N315            LRRDQHDGVYKFPEEVSLLQQYFGPAHQQAYVRAYPAVGKNVPLYILGSSTDSAHLAARK
    NCTC8325        LRRDQHDGVYKFPEEVSLLQQYFGPAHQQAYVRAYPAVGKNVPLYILGSSTDSAHLAARK
    Newman          LRRDQHDGVYKFPEEVSLLQQYFGPAHQQAYVRAYPAVGKNVPLYILGSSTDSAHLAARK
    USA300_FPR3757  LRRDQHDGVYKFPEEVSLLQQYFGPAHQQAYVRAYPAVGKNVPLYILGSSTDSAHLAARK
                    ************************************************************

    COL             GLPYVFAGHFAPQQMKEAIEIYKTLFEPSDVLDEPYVIVCLNTIVAENDDEAQYLASSMA
    N315            GLPYVFAGHFAPQQMKEAIEIYKTLFEPSDVLDEPYVIVCLNTIVAENDDEAQYLASSMA
    NCTC8325        GLPYVFAGHFAPQQMKEAIEIYKTLFEPSDVLDEPYVIVCLNTIVAENDDEAQYLASSMA
    Newman          GLPYVFAGHFAPQQMKEAIEIYKTLFEPSDVLDEPYVIVCLNTIVAENDDEAQYLASSMA
    USA300_FPR3757  GLPYVFAGHFAPQQMKEAIEIYKTLFEPSDVLDEPYVIVCLNTIVAENDDEAQYLASSMA
                    ************************************************************

    COL             QVMVSITRGRMQPVQPPTHELQNILTPREYAMAMERQKISLIGSENTVQQKIQDFMETYG
    N315            QVMVSITRGRMQPVQPPTHDLQNILTPREYAMAMERQKISLIGSENTVQQKIQDFMETYG
    NCTC8325        QVMVSITRGRMQPVQPPTHELQNILTPREYAMAMERQKISLIGSENTVQQKIQDFMETYG
    Newman          QVMVSITRGRMQPVQPPTHELQNILTPREYAMAMERQKISLIGSENTVQQKIQDFMETYG
    USA300_FPR3757  QVMVSITRGRMQPVQPPTHELQNILTPREYAMAMERQKISLIGSENTVQQKIQDFMETYG
                    *******************:****************************************

    COL             EVNEIMAISYIYDKDMQLDSYRRFKNVINQINEKNTL
    N315            EVNEIMAISYIYDKDMQLDSYRRFKNVINQINEKNTL
    NCTC8325        EVNEIMAISYIYDKDMQLDSYRRFKNVINQINEKNTL
    Newman          EVNEIMAISYIYDKDMQLDSYRRFKNVINQINEKNTL
    USA300_FPR3757  EVNEIMAISYIYDKDMQLDSYRRFKNVINQINEKNTL
                    *************************************