From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004226000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4475719..4475865
  • synteny block?: BlockID0032540
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1582
    08BA02176:
    C248_1666
    11819-97:
    MS7_1640
    71193:
    ST398NM01_1688
    ECT-R 2:
    ECTR2_1473
    ED133:
    SAOV_1622
    ED98:
    SAAV_1617
    HO 5096 0412:
    SAEMRSA15_15420
    JH1:
    SaurJH1_1715
    JH9:
    SaurJH9_1682
    JKD6008:
    SAA6008_01594
    JKD6159:
    SAA6159_01557
    LGA251:
    SARLGA251_15270
    M013:
    M013TW_1645
    MRSA252:
    SAR1704
    MSHR1132:
    SAMSHR1132_14610
    MSSA476:
    SAS1560
    Mu3:
    SAHV_1611
    Mu50:
    SAV1624
    MW2:
    MW1574
    RF122:
    ST398:
    SAPIG1688
    T0131:
    SAT0131_01721
    TCH60:
    HMPREF0772_11517
    TW20:
    SATW20_16190
    USA300_TCH1516:
    USA300HOU_1624
    VC40:
    SAVC_07370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
    N315            MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
    NCTC8325        MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
    Newman          MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
    USA300_FPR3757  MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
                    ************************************************