From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004227000
  • symbol?: csbD
  • description?: CsbD family protein

      descriptions from strain specific annotations:

    • CsbD family protein
    • sigmaB-controlled gene product
    • csbD-like family protein
    • putative universal stress response protein
    • sigma-B mediated bacterial general stress response protein
  • strand?: -
  • coordinates?: 4475905..4476087
  • synteny block?: BlockID0032550
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1452 (csbD)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1583 (csbD)
    08BA02176:
    C248_1667
    11819-97:
    MS7_1641
    71193:
    ST398NM01_1689
    ECT-R 2:
    ECTR2_1474
    ED133:
    SAOV_1623
    ED98:
    SAAV_1618
    HO 5096 0412:
    SAEMRSA15_15430
    JH1:
    SaurJH1_1716
    JH9:
    SaurJH9_1683
    JKD6008:
    SAA6008_01595 (csbD)
    JKD6159:
    SAA6159_01558 (csbD)
    LGA251:
    SARLGA251_15280
    M013:
    M013TW_1646
    MRSA252:
    SAR1705
    MSHR1132:
    SAMSHR1132_14620
    MSSA476:
    SAS1561
    Mu3:
    SAHV_1612 (csbD)
    Mu50:
    SAV1625 (csbD)
    MW2:
    MW1575 (csbD)
    RF122:
    ST398:
    SAPIG1689
    T0131:
    SAT0131_01722
    TCH60:
    HMPREF0772_11516 (csbD)
    TW20:
    SATW20_16200
    USA300_TCH1516:
    USA300HOU_1625
    VC40:
    SAVC_07375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
    N315            MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLKK
    NCTC8325        MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLKK
    Newman          MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
    USA300_FPR3757  MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
                    ***********************************. ***********************