From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004231000
  • symbol?:
  • description?: hesA/moeB/thiF family protein

      descriptions from strain specific annotations:

    • hesA/moeB/thiF family protein
    • ThiF family protein
    • UBA/THIF-type NAD/FAD binding protein
    • HesA/MoeB/ThiF family protein related toEC-YgdL
    • ThiF/MoeB family protein
    • dinucleotide-utilizing enzyme
    • ThiF/MoeB/HesA family protein
  • strand?: -
  • coordinates?: 4478176..4478949
  • synteny block?: BlockID0032590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1586
    08BA02176:
    C248_1670
    11819-97:
    MS7_1644
    71193:
    ST398NM01_1692
    ECT-R 2:
    ECTR2_1477
    ED133:
    SAOV_1626
    ED98:
    SAAV_1621
    HO 5096 0412:
    SAEMRSA15_15460
    JH1:
    SaurJH1_1719
    JH9:
    SaurJH9_1686
    JKD6008:
    SAA6008_01598
    JKD6159:
    SAA6159_01561
    LGA251:
    SARLGA251_15310
    M013:
    M013TW_1649
    MRSA252:
    SAR1708
    MSHR1132:
    SAMSHR1132_14650
    MSSA476:
    SAS1564
    Mu3:
    SAHV_1615
    Mu50:
    SAV1628
    MW2:
    MW1578
    RF122:
    SAB1498c
    ST398:
    SAPIG1692
    T0131:
    SAT0131_01726
    TCH60:
    HMPREF0772_11513
    TW20:
    SATW20_16230
    USA300_TCH1516:
    USA300HOU_1626
    VC40:
    SAVC_07390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKHQFSRNELAIGQQGLDLLKQQTVVILGVGGVGSFAAEALARTNIGHIILIDKDDVDIT
    N315            MKHQFSRNELAIGQQGLDLLKQQTVVILGVGGVGSFAAEALARTNIGHIILIDKDDVDIT
    NCTC8325        MKHQFSRNELAIGQQGLDLLKQQTVVILGVGGVGSFAAEALARTNIGHIILIDKDDVDIT
    Newman          MKHQFSRNELAIGQQGLDLLKQQTVVILGVGGVGSFAAEALARTNIGHIILIDKDDVDIT
    USA300_FPR3757  MKHQFSRNELAIGQQGLDLLKQQTVVILGVGGVGSFAAEALARTNIGHIILIDKDDVDIT
                    ************************************************************

    COL             NVNRQLHALTTTVGQSKVSLMEERIKLINPDCKVTPLHMFYTEETYEEIFDNYDIDYFVD
    N315            NVNRQLHALTTTVGQSKVSLMEERIKLINPDCKVTPLHMFYTEETYEEIFDNYDIDYFVD
    NCTC8325        NVNRQLHALTTTVGQSKVSLMEERIKLINPDCKVTPLHMFYTEETYEEIFDNYDIDYFVD
    Newman          NVNRQLHALTTTVGQSKVSLMEERIKLINPDCKVTPLHMFYTEETYEEIFDNYDIDYFVD
    USA300_FPR3757  NVNRQLHALTTTVGQSKVSLMEERIKLINPDCKVTPLHMFYTEETYEEIFDNYDIDYFVD
                    ************************************************************

    COL             ASDTIMYKVHLMKECLDRGIKVISSMGAANKTDPTRFTISDISKTHTDPMAKIIRQKLKK
    N315            ASDTIMYKVHLMKECLDRGIKVISSMGAANKTDPTRFTISDISKTHTDPMAKIIRQKLKK
    NCTC8325        ASDTIMYKVHLMKECLDRGIKVISSMGAANKTDPTRFTISDISKTHTDPMAKIIRQKLKK
    Newman          ASDTIMYKVHLMKECLDRGIKVISSMGAANKTDPTRFTISDISKTHTDPMAKIIRQKLKK
    USA300_FPR3757  ASDTIMYKVHLMKECLDRGIKVISSMGAANKTDPTRFTISDISKTHTDPMAKIIRQKLKK
                    ************************************************************

    COL             LGIRKGIPVVFSDESPIVIREDVKDIVGDKNAINRKGQMPPSSNAFVPSVVGLICASYVV
    N315            LGIRKGIPVVFSDESPIVIREDVKDIVGDKNAINRKGQMPPSSNAFVPSVVGLICASYVV
    NCTC8325        LGIRKGIPVVFSDESPIVIREDVKDIVGDKNAINRKGQMPPSSNAFVPSVVGLICASYVV
    Newman          LGIRKGIPVVFSDESPIVIREDVKDIVGDKNAINRKGQMPPSSNAFVPSVVGLICASYVV
    USA300_FPR3757  LGIRKGIPVVFSDESPIVIREDVKDIVGDKNAINRKGQMPPSSNAFVPSVVGLICASYVV
                    ************************************************************

    COL             NDVLKDIPVRRIKDKGQ
    N315            NDVLKDIPVRRIKDKGQ
    NCTC8325        NDVLKDIPVRRIKDKGQ
    Newman          NDVLKDIPVRRIKDKGQ
    USA300_FPR3757  NDVLKDIPVRRIKDKGQ
                    *****************