From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004249000
  • symbol?: thrR
  • description?: ACT domain-containing protein

      descriptions from strain specific annotations:

    • ACT domain-containing protein
    • ACT domain-containing protein pheB
    • putative DNA-binding protein
    • chorismate mutase
  • strand?: -
  • coordinates?: 4496582..4497037
  • synteny block?: BlockID0032770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1601
    08BA02176:
    C248_1686
    11819-97:
    MS7_1658
    71193:
    ST398NM01_1706
    ECT-R 2:
    ECTR2_1491
    ED133:
    SAOV_1640
    ED98:
    SAAV_1636
    HO 5096 0412:
    SAEMRSA15_15600
    JH1:
    SaurJH1_1733
    JH9:
    SaurJH9_1700
    JKD6008:
    SAA6008_01612
    JKD6159:
    SAA6159_01575
    LGA251:
    SARLGA251_15450
    M013:
    M013TW_1663
    MRSA252:
    SAR1723
    MSHR1132:
    SAMSHR1132_14790
    MSSA476:
    SAS1579
    Mu3:
    SAHV_1630
    Mu50:
    SAV1643
    MW2:
    MW1593
    RF122:
    SAB1512c
    ST398:
    SAPIG1706
    T0131:
    SAT0131_01743
    TCH60:
    HMPREF0772_11499 (pheB)
    TW20:
    SATW20_16370
    USA300_TCH1516:
    USA300HOU_1642
    VC40:
    SAVC_07460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAFYKYRET
    N315            MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAFYKYRET
    NCTC8325        -MDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAFYKYRET
    Newman          MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAFYKYRET
    USA300_FPR3757  -MDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAFYKYRET
                     ***********************************************************

    COL             IFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKATITLSL
    N315            IFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKATITLSL
    NCTC8325        IFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKATITLSL
    Newman          IFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKATITLSL
    USA300_FPR3757  IFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKATITLSL
                    ************************************************************

    COL             NAKSKETSVEDVIGALRNLDYVSKVELISMSM
    N315            NAKSKETSVEDVIGALRNLDYVSKVELISMSM
    NCTC8325        NAKSKETSVEDVIGALRNLDYVSKVELISMSM
    Newman          NAKSKETSVEDVIGALRNLDYVSKVELISMSM
    USA300_FPR3757  NAKSKETSVEDVIGALRNLDYVSKVELISMSM
                    ********************************