From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004250000
  • symbol?: obgE
  • description?: GTPase ObgE

      descriptions from strain specific annotations:

    • GTPase ObgE
    • GTPase CgtA
    • GTP-binding protein CgtA
    • GTP-binding protein Obg
    • GTP-binding protein Obg/CgtA
    • obg family GTPase CgtA
    • Spo0B-associated GTP-binding protein
  • strand?: -
  • coordinates?: 4497050..4498342
  • synteny block?: BlockID0032780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1699 (obgE)
    N315:
    SA1470 (obgE)
    NCTC8325:
    Newman:
    NWMN_1546 (obgE)
    USA300_FPR3757:
    04-02981:
    SA2981_1602 (obg)
    08BA02176:
    C248_1687 (obg)
    11819-97:
    MS7_1659 (cgtA)
    71193:
    ST398NM01_1707
    ECT-R 2:
    ECTR2_1492
    ED133:
    SAOV_1641
    ED98:
    SAAV_1637 (obgE)
    HO 5096 0412:
    SAEMRSA15_15610 (obg)
    JH1:
    SaurJH1_1734 (obgE)
    JH9:
    SaurJH9_1701 (obgE)
    JKD6008:
    SAA6008_01613 (obgE)
    JKD6159:
    SAA6159_01576 (obgE)
    LGA251:
    SARLGA251_15460 (obg)
    M013:
    M013TW_1664
    MRSA252:
    SAR1724 (obgE)
    MSHR1132:
    SAMSHR1132_14800
    MSSA476:
    SAS1580 (obgE)
    Mu3:
    SAHV_1631 (obgE)
    Mu50:
    SAV1644 (obgE)
    MW2:
    MW1594 (obgE)
    RF122:
    SAB1513c (obgE)
    ST398:
    SAPIG1707
    T0131:
    SAT0131_01744 (atoB)
    TCH60:
    HMPREF0772_11498 (cgtA)
    TW20:
    SATW20_16380 (obg)
    USA300_TCH1516:
    USA300HOU_1643 (obgE)
    VC40:
    SAVC_07465 (obgE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFVDQVKISLKAGDGGNGITAYRREKYVPFGGPAGGDGGKGASVVFEVDEGLRTLLDFRY
    N315            MFVDQVKISLKAGDGGNGITAYRREKYVPFGGPAGGDGGKGASVVFEVDEGLRTLLDFRY
    NCTC8325        MFVDQVKISLKAGDGGNGITAYRREKYVPFGGPAGGDGGKGASVVFEVDEGLRTLLDFRY
    Newman          MFVDQVKISLKAGDGGNGITAYRREKYVPFGGPAGGDGGKGASVVFEVDEGLRTLLDFRY
    USA300_FPR3757  MFVDQVKISLKAGDGGNGITAYRREKYVPFGGPAGGDGGKGASVVFEVDEGLRTLLDFRY
                    ************************************************************

    COL             QRHFKASKGENGQSSNMHGKNAEDLVLKVPPGTIIKNVETDEVLADLVEDGQRAVVAKGG
    N315            QRHFKASKGENGQSSNMHGKNAEDLVLKVPPGTIIKNVETDEVLADLVEDGQRAVVAKGG
    NCTC8325        QRHFKASKGENGQSSNMHGKNAEDLVLKVPPGTIIKNVETDEVLADLVEDGQRAVVAKGG
    Newman          QRHFKASKGENGQSSNMHGKNAEDLVLKVPPGTIIKNVETDEVLADLVEDGQRAVVAKGG
    USA300_FPR3757  QRHFKASKGENGQSSNMHGKNAEDLVLKVPPGTIIKNVETDEVLADLVEDGQRAVVAKGG
                    ************************************************************

    COL             RGGRGNSRFATPRNPAPDFSEKGEPGEELDVSLELKLLADVGLVGFPSVGKSTLLSIVSK
    N315            RGGRGNSRFATPRNPAPDFSEKGEPGEELDVSLELKLLADVGLVGFPSVGKSTLLSIVSK
    NCTC8325        RGGRGNSRFATPRNPAPDFSEKGEPGEELDVSLELKLLADVGLVGFPSVGKSTLLSIVSK
    Newman          RGGRGNSRFATPRNPAPDFSEKGEPGEELDVSLELKLLADVGLVGFPSVGKSTLLSIVSK
    USA300_FPR3757  RGGRGNSRFATPRNPAPDFSEKGEPGEELDVSLELKLLADVGLVGFPSVGKSTLLSIVSK
                    ************************************************************

    COL             AKPKIGAYHFTTIKPNLGVVSTPDQRSFVMADLPGLIEGASDGVGLGHQFLRHVERTKVI
    N315            AKPKIGAYHFTTIKPNLGVVSTPDQRSFVMADLPGLIEGASDGVGLGHQFLRHVERTKVI
    NCTC8325        AKPKIGAYHFTTIKPNLGVVSTPDQRSFVMADLPGLIEGASDGVGLGHQFLRHVERTKVI
    Newman          AKPKIGAYHFTTIKPNLGVVSTPDQRSFVMADLPGLIEGASDGVGLGHQFLRHVERTKVI
    USA300_FPR3757  AKPKIGAYHFTTIKPNLGVVSTPDQRSFVMADLPGLIEGASDGVGLGHQFLRHVERTKVI
                    ************************************************************

    COL             VHMIDMSGSEGREPIEDYKVINQELAAYEQRLEDRPQIVVANKMDLPESQDNLNLFKEEI
    N315            VHMIDMSGSEGREPIEDYKVINQELAAYEQRLEDRPQIVVANKMDLPESQDNLNLFKEEI
    NCTC8325        VHMIDMSGSEGREPIEDYKVINQELAAYEQRLEDRPQIVVANKMDLPESQDNLNLFKEEI
    Newman          VHMIDMSGSEGREPIEDYKVINQELAAYEQRLEDRPQIVVANKMDLPESQDNLNLFKEEI
    USA300_FPR3757  VHMIDMSGSEGREPIEDYKVINQELAAYEQRLEDRPQIVVANKMDLPESQDNLNLFKEEI
                    ************************************************************

    COL             GEDVPVIPVSTITRDNIDQLLYAIADKLEEYKDVDITVEEEESVGINRVLYKHTPSQDKF
    N315            GEDVPVIPVSTITRDNIDQLLYAIADKLEEYKDVDFTVEEEESVGINRVLYKHTPSQDKF
    NCTC8325        GEDVPVIPVSTITRDNIDQLLYAIADKLEEYKDVDFTVEEEESVGINRVLYKHTPSQDKF
    Newman          GEDVPVIPVSTITRDNIDQLLYAIADKLEEYKDVDFTVEEEESVGINRVLYKHTPSQDKF
    USA300_FPR3757  GEDVPVIPVSTITRDNIDQLLYAIADKLEEYKDVDFTVEEEESVGINRVLYKHTPSQDKF
                    ***********************************:************************

    COL             TISRDDDGAYVVSGNAIERMFKMTDFNSDPAVRRFARQMRSMGIDDALRERGCKNGDIVR
    N315            TISRDDDGAYVVSGNAIERMFKMTDFNSDPAVRRFARQMRSMGIDDALRERGCKNGDIVR
    NCTC8325        TISRDDDGAYVVSGNAIERMFKMTDFNSDPAVRRFARQMRSMGIDDALRERGCKNGDIVR
    Newman          TISRDDDGAYVVSGNAIERMFKMTDFNSDPAVRRFARQMRSMGIDDALRERGCKNGDIVR
    USA300_FPR3757  TISRDDDGAYVVSGNAIERMFKMTDFNSDPAVRRFARQMRSMGIDDALRERGCKNGDIVR
                    ************************************************************

    COL             ILGGEFEFVE
    N315            ILGGEFEFVE
    NCTC8325        ILGGEFEFVE
    Newman          ILGGEFEFVE
    USA300_FPR3757  ILGGEFEFVE
                    **********