From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004251000
  • symbol?: rpmA
  • description?: 50S ribosomal protein L27

      descriptions from strain specific annotations:

    • 50S ribosomal protein L27
    • 50S ribosomal protei L27
    • 50S ribosomal protein L25
  • strand?: -
  • coordinates?: 4499794..4500078
  • synteny block?: BlockID0032790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1700 (rpmA)
    N315:
    SA1471 (rpmA)
    NCTC8325:
    Newman:
    NWMN_1547 (rpmA)
    USA300_FPR3757:
    04-02981:
    SA2981_1603 (rpmA)
    08BA02176:
    C248_1688 (rpmA)
    11819-97:
    MS7_1660 (rpmA)
    71193:
    ST398NM01_1708
    ECT-R 2:
    ECTR2_1493 (rpmA)
    ED133:
    SAOV_1642 (rpmA)
    ED98:
    SAAV_1638 (rpmA)
    HO 5096 0412:
    SAEMRSA15_15620 (rpmA)
    JH1:
    SaurJH1_1735 (rpmA)
    JH9:
    SaurJH9_1702 (rpmA)
    JKD6008:
    SAA6008_01614 (rpmA)
    JKD6159:
    SAA6159_01577 (rpmA)
    LGA251:
    SARLGA251_15470 (rpmA)
    M013:
    M013TW_1665
    MRSA252:
    SAR1725 (rpmA)
    MSHR1132:
    SAMSHR1132_14810
    MSSA476:
    SAS1581 (rpmA)
    Mu3:
    SAHV_1632 (rpmA)
    Mu50:
    SAV1645 (rpmA)
    MW2:
    MW1595 (rpmA)
    RF122:
    SAB1514c (rpmA)
    ST398:
    SAPIG1708 (rpmA)
    T0131:
    SAT0131_01746
    TCH60:
    HMPREF0772_11497 (rpmA)
    TW20:
    SATW20_16390 (rpmA)
    USA300_TCH1516:
    USA300HOU_1644 (rpmA)
    VC40:
    SAVC_07470 (rpmA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
    N315            MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
    NCTC8325        MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
    Newman          MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
    USA300_FPR3757  MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
                    ************************************************************

    COL             RGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE
    N315            RGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE
    NCTC8325        RGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE
    Newman          RGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE
    USA300_FPR3757  RGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE
                    **********************************