From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004253000
  • symbol?: rplU
  • description?: 50S ribosomal protein L21
  • strand?: -
  • coordinates?: 4500416..4500724
  • synteny block?: BlockID0032810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1702 (rplU)
    N315:
    SA1473 (rplU)
    NCTC8325:
    Newman:
    NWMN_1549 (rplU)
    USA300_FPR3757:
    04-02981:
    SA2981_1605 (rplU)
    08BA02176:
    C248_1690 (rplU)
    11819-97:
    MS7_1662 (rplU)
    71193:
    ST398NM01_1710
    ECT-R 2:
    ECTR2_1495 (rplU)
    ED133:
    SAOV_1644 (rplU)
    ED98:
    SAAV_1640 (rplU)
    HO 5096 0412:
    SAEMRSA15_15640 (rplU)
    JH1:
    SaurJH1_1737 (rplU)
    JH9:
    SaurJH9_1704 (rplU)
    JKD6008:
    SAA6008_01616 (rplU)
    JKD6159:
    SAA6159_01579 (rplU)
    LGA251:
    SARLGA251_15490 (rplU)
    M013:
    M013TW_1667
    MRSA252:
    SAR1727 (rplU)
    MSHR1132:
    SAMSHR1132_14830
    MSSA476:
    SAS1583 (rplU)
    Mu3:
    SAHV_1634 (rplU)
    Mu50:
    SAV1647 (rplU)
    MW2:
    MW1597 (rplU)
    RF122:
    SAB1516c (rplU)
    ST398:
    SAPIG1710 (rplU)
    T0131:
    SAT0131_01748
    TCH60:
    HMPREF0772_11495 (rplU)
    TW20:
    SATW20_16410 (rplU)
    USA300_TCH1516:
    USA300HOU_1646 (rplU)
    VC40:
    SAVC_07480 (rplU)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTA
    N315            MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTA
    NCTC8325        MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTA
    Newman          MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTA
    USA300_FPR3757  MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTA
                    ************************************************************

    COL             TVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
    N315            TVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
    NCTC8325        TVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
    Newman          TVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
    USA300_FPR3757  TVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
                    ******************************************