From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004259000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 4503723..4503938
  • synteny block?: BlockID0032870
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1610
    08BA02176:
    C248_1695
    11819-97:
    71193:
    ST398NM01_2887
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_15690
    JH1:
    SaurJH1_1742
    JH9:
    SaurJH9_1709
    JKD6008:
    JKD6159:
    SAA6159_01584
    LGA251:
    M013:
    MRSA252:
    SAR1731
    MSHR1132:
    MSSA476:
    SAS1587
    Mu3:
    SAHV_1638
    Mu50:
    SAV1651
    MW2:
    MW1602
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11491
    TW20:
    USA300_TCH1516:
    VC40:
    SAVC_07505

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MSILTIILIALLVILLFRVGLSILRFLIYVGLVLLCIYLGYQGLIWLLDFFQINSGFLPH
    Newman          -----------------------MRFLIYVGLVLLCIYLGYQGLIWLLDFFQINSGFLPH
                                           :************************************

    N315            FQFNN
    Newman          FQFNN
                    *****