From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004262000
  • symbol?: radC
  • description?: DNA repair protein RadC

      descriptions from strain specific annotations:

    • DNA repair protein RadC
    • Putative DNA repair protein, RadC
    • DNA repair protein RadC family protein
    • DNA repair protein RadC-like protein
    • DNA repair RadC family protein
    • truncated DNA repair protein RadC
  • strand?: -
  • coordinates?: 4504407..4518755
  • synteny block?: BlockID0032900
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1707 (radC)
    N315:
    SA1485 (radC)
    NCTC8325:
    Newman:
    NWMN_1555 (radC)
    USA300_FPR3757:
    04-02981:
    SA2981_1619 (radC)
    08BA02176:
    C248_1702 (radC)
    11819-97:
    MS7_1668
    71193:
    ST398NM01_1715
    ECT-R 2:
    ECTR2_1501
    ED133:
    SAOV_1649
    ED98:
    SAAV_1646 (radC)
    HO 5096 0412:
    SAEMRSA15_15710 (radC)
    JH1:
    SaurJH1_1752
    JH9:
    SaurJH9_1718
    JKD6008:
    SAA6008_01628
    JKD6159:
    SAA6159_01586 (radC)
    LGA251:
    SARLGA251_15540 (radC)
    M013:
    M013TW_1674
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1589 (radC)
    Mu3:
    SAHV_1647
    Mu50:
    SAV1660 (truncated-radC)
    MW2:
    MW1604 (radC)
    RF122:
    SAB1521c (radC)
    ST398:
    SAPIG1715
    T0131:
    SAT0131_01761
    TCH60:
    HMPREF0772_11489 (radC)
    TW20:
    USA300_TCH1516:
    USA300HOU_1652 (radC)
    VC40:
    SAVC_07515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIKEMVTSEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNEL
    N315            MKIKEMVTSEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNEL
    NCTC8325        ----------MPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNEL
    Newman          MKIKEMVTSEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNEL
    USA300_FPR3757  ----------MPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNEL
                              **************************************************

    COL             KKSSINDLIKVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDL
    N315            KKSSINDLIKVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDL
    NCTC8325        KKSSINDLIKVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDL
    Newman          KKSSINDLIKVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDL
    USA300_FPR3757  KKSSINDLIKVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDL
                    ************************************************************

    COL             TQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDV
    N315            TQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDV
    NCTC8325        TQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDV
    Newman          TQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDV
    USA300_FPR3757  TQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDV
                    ************************************************************

    COL             TPSQEDIITTMRLKECGLILGIDLLDHIIIGDNRFTSLVEAGYFDEND
    N315            -------LTIV-------------------------------------
    NCTC8325        TPSQEDIITTMRLKECGLILGIDLLDHIIIGDNRFTSLVEAGYFDEND
    Newman          TPSQEDIITTMRLKECGLILGIDLLDHIIIGDNRFTSLVEAGYFDEND
    USA300_FPR3757  TPSQEDIITTMRLKECGLILGIDLLDHIIIGDNRFTSLVEAGYFDEND
                           :* :