From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004293000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4537711..4538642
  • synteny block?: BlockID0033170
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1636
    08BA02176:
    C248_1718
    11819-97:
    MS7_1684
    71193:
    ST398NM01_1731
    ECT-R 2:
    ECTR2_1517
    ED133:
    SAOV_1665
    ED98:
    SAAV_1664
    HO 5096 0412:
    SAEMRSA15_15870
    JH1:
    SaurJH1_1768
    JH9:
    SaurJH9_1734
    JKD6008:
    SAA6008_01644
    JKD6159:
    SAA6159_01601
    LGA251:
    SARLGA251_15690
    M013:
    M013TW_1690
    MRSA252:
    SAR1756
    MSHR1132:
    SAMSHR1132_15040
    MSSA476:
    SAS1605
    Mu3:
    SAHV_1663
    Mu50:
    SAV1676
    MW2:
    MW1620
    RF122:
    SAB1536c
    ST398:
    SAPIG1731
    T0131:
    TCH60:
    HMPREF0772_11474
    TW20:
    SATW20_16670
    USA300_TCH1516:
    VC40:
    SAVC_07590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDIIQFPNSSKKLYKDIKRAEQDQNYDLMYEYIVQYERQFELTEEIAMMKCRMLYETGS
    N315            MSDIIQFPNSSKKLYKDIKRAEQDQNYDLMYEYIVQYERQFELTEEIAMMKCRMLYETGS
    NCTC8325        MSDIIQFPNSSKKLYKDIKRAEQDQNYDLMYEYIVQYERQFELTEEIAMMKCRMLYETGS
    Newman          MSDIIQFPNSSKKLYKDIKRAEQDQNYDLMYEYIVQYERQFELTEEIAMMKCRMLYETGS
    USA300_FPR3757  MSDIIQFPNSSKKLYKDIKRAEQDQNYDLMYEYIVQYERQFELTEEIAMMKCRMLYETGS
                    ************************************************************

    COL             FLELREETIVLLKTGIQQYDALMIYYVKSLIGLGQYFEAVEVIHQIIDEVKDHKTRMALH
    N315            FLELREETIVLLKTGIQQYDALMIYYVKSLIGLGQYFEAVEVIHQIIDEVKDHKTRMALH
    NCTC8325        FLELREETIVLLKTGIQQYDALMIYYVKSLIGLGQYFEAVEVIHQIIDEVKDHKTRMALH
    Newman          FLELREETIVLLKTGIQQYDALMIYYVKSLIGLGQYFEAVEVIHQIIDEVKDHKTRMALH
    USA300_FPR3757  FLELREETIVLLKTGIQQYDALMIYYVKSLIGLGQYFEAVEVIHQIIDEVKDHKTRMALH
                    ************************************************************

    COL             PLKEFAKSKLIEDEKRLTQSLADFDTLSMREQTHLILKLIDNGHFQFQETVLYILKSNTY
    N315            PLKEFAKSKLIEDEKRLTQSLTDFDTLSMREQTHLILKLIDNGHFQFQETVLYILKSNTY
    NCTC8325        PLKEFAKSKLIEDEKRLTQSLADFDTLSMREQTHLILKLIDNGHFQFQETVLYILKSNTY
    Newman          PLKEFAKSKLIEDEKRLTQSLADFDTLSMREQTHLILKLIDNGHFQFQETVLYILKSNTY
    USA300_FPR3757  PLKEFAKSKLIEDEKRLTQSLADFDTLSMREQTHLILKLIDNGHFQFQETVLYILKSNTY
                    *********************:**************************************

    COL             SYNLISLMIEYLRFANCTQELTIEKYGMDVTFVPANLKGLEHTTLKEKVIPNVMETLNDG
    N315            SYNLISLMIEYLRFANCTQELTIEKYGMDVTFVPANLNGLEHTTLKEKVIPNVMETLNDG
    NCTC8325        SYNLISLMIEYLRFANCTQELTIEKYGMDVTFVPANLKGLEHTTLKEKVIPNVMETLNDG
    Newman          SYNLISLMIEYLRFANCTQELTIEKYGMDVTFVPANLKGLEHTTLKEKVIPNVMETLNDG
    USA300_FPR3757  SYNLISLMIEYLRFANCTQELTIEKYGMDVTFVPANLKGLEHTTLKEKVIPNVMETLNDG
                    *************************************:**********************

    COL             ALHIAEEAHHIMNNHSIMIYPIDIETLFETNKWINAYECYFKNMLGLKCELQSIDAFNFI
    N315            ALHIAEEAHHIMNNHSIMIYPIDIETLFETNKWINAYECYFKNMLGLKCELQSIDAFNFI
    NCTC8325        ALHIAEEAHHIMNNHSIMIYPIDIETLFETNKWINAYECYFKNMLGLKCELQSIDAFNFI
    Newman          ALHIAEEAHHIMNNHSIMIYPIDIETLFETNKWINAYECYFKNMLGLKCELQSIDAFNFI
    USA300_FPR3757  ALHIAEEAHHIMNNHSIMIYPIDIETLFETNKWINAYECYFKNMLGLKCELQSIDAFNFI
                    ************************************************************

    COL             QQLDLNNNS
    N315            QQLDLNNNS
    NCTC8325        QQLDLNNNS
    Newman          QQLDLNNNS
    USA300_FPR3757  QQLDLNNNS
                    *********