From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004297000
  • symbol?: rplT
  • description?: 50S ribosomal protein L20
  • strand?: -
  • coordinates?: 4539415..4539771
  • synteny block?: BlockID0033210
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1725 (rplT)
    N315:
    SA1502 (rplT)
    NCTC8325:
    Newman:
    NWMN_1572 (rplT)
    USA300_FPR3757:
    04-02981:
    SA2981_1638 (rplT)
    08BA02176:
    C248_1720 (rplT)
    11819-97:
    MS7_1686 (rplT)
    71193:
    ST398NM01_1733
    ECT-R 2:
    ECTR2_1519 (rplT)
    ED133:
    SAOV_1667 (rplT)
    ED98:
    SAAV_1666 (rplT)
    HO 5096 0412:
    SAEMRSA15_15890 (rplT)
    JH1:
    SaurJH1_1770 (rplT)
    JH9:
    SaurJH9_1736 (rplT)
    JKD6008:
    SAA6008_01646 (rplT)
    JKD6159:
    SAA6159_01603 (rplT)
    LGA251:
    SARLGA251_15710 (rplT)
    M013:
    M013TW_1692
    MRSA252:
    SAR1758 (rplT)
    MSHR1132:
    SAMSHR1132_15060
    MSSA476:
    SAS1607 (rplT)
    Mu3:
    SAHV_1665 (rplT)
    Mu50:
    SAV1678 (rplT)
    MW2:
    MW1622 (rplT)
    RF122:
    SAB1538c (rplT)
    ST398:
    SAPIG1733 (rplT)
    T0131:
    SAT0131_01781
    TCH60:
    HMPREF0772_11472 (rplT)
    TW20:
    SATW20_16690 (rplT)
    USA300_TCH1516:
    VC40:
    SAVC_07600 (rplT)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL
    N315            MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL
    NCTC8325        MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL
    Newman          MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL
    USA300_FPR3757  MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL
                    ************************************************************

    COL             WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK
    N315            WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK
    NCTC8325        WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK
    Newman          WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK
    USA300_FPR3757  WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK
                    **********************************************************