From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004299000
  • symbol?: infC
  • description?: translation initiation factor IF-3

      descriptions from strain specific annotations:

    • translation initiation factor IF-3
    • protein translation initiation factor 3 (IF-3)
    • Translation initiation factor 3
  • strand?: -
  • coordinates?: 4540047..4540565
  • synteny block?: BlockID0033230
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1727 (infC)
    N315:
    SA1504 (infC)
    NCTC8325:
    Newman:
    NWMN_1574 (infC)
    USA300_FPR3757:
    04-02981:
    SA2981_1640 (infC)
    08BA02176:
    C248_1722 (infC)
    11819-97:
    MS7_1688 (infC)
    71193:
    ST398NM01_1735
    ECT-R 2:
    ECTR2_1521 (infC)
    ED133:
    SAOV_1669
    ED98:
    SAAV_1668 (infC)
    HO 5096 0412:
    SAEMRSA15_15910 (infC)
    JH1:
    SaurJH1_1772 (infC)
    JH9:
    SaurJH9_1738 (infC)
    JKD6008:
    SAA6008_01648 (infC)
    JKD6159:
    SAA6159_01605 (infC)
    LGA251:
    SARLGA251_15730 (infC)
    M013:
    M013TW_1694
    MRSA252:
    SAR1760 (infC)
    MSHR1132:
    SAMSHR1132_15080
    MSSA476:
    SAS1609 (infC)
    Mu3:
    SAHV_1667 (infC)
    Mu50:
    SAV1680 (infC)
    MW2:
    MW1624 (infC)
    RF122:
    SAB1540c (infC)
    ST398:
    SAPIG1735 (infC)
    T0131:
    SAT0131_01783
    TCH60:
    HMPREF0772_11470 (infC)
    TW20:
    SATW20_16710 (infC)
    USA300_TCH1516:
    VC40:
    SAVC_07610 (infC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPV
    N315            ---MAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPV
    NCTC8325        MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPV
    Newman          MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPV
    USA300_FPR3757  MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPV
                       :********************************************************

    COL             ARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKC
    N315            ARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKC
    NCTC8325        ARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKC
    Newman          ARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKC
    USA300_FPR3757  ARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKC
                    ************************************************************

    COL             KVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
    N315            KVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
    NCTC8325        KVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
    Newman          KVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
    USA300_FPR3757  KVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
                    *******************************************************