From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004310000
  • symbol?: coaE
  • description?: dephospho-CoA kinase

      descriptions from strain specific annotations:

    • dephospho-CoA kinase
    • putative dephospho-CoA kinase
  • strand?: -
  • coordinates?: 4549321..4551683
  • synteny block?: BlockID0033340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1735 (coaE)
    N315:
    SA1511 (coaE)
    NCTC8325:
    Newman:
    NWMN_1581 (coaE)
    USA300_FPR3757:
    04-02981:
    SA2981_1647
    08BA02176:
    C248_1730 (coaE)
    11819-97:
    MS7_1695 (coaE)
    71193:
    ST398NM01_1742
    ECT-R 2:
    ECTR2_1528 (coaE)
    ED133:
    SAOV_1676 (coaE)
    ED98:
    SAAV_1678 (coaE)
    HO 5096 0412:
    SAEMRSA15_15980 (coaE)
    JH1:
    SaurJH1_1779 (coaE)
    JH9:
    SaurJH9_1745 (coaE)
    JKD6008:
    SAA6008_01655 (coaE)
    JKD6159:
    SAA6159_01612 (coaE)
    LGA251:
    SARLGA251_15800 (coaE)
    M013:
    M013TW_1701
    MRSA252:
    SAR1767 (coaE)
    MSHR1132:
    SAMSHR1132_15190
    MSSA476:
    SAS1616 (coaE)
    Mu3:
    SAHV_1674 (coaE)
    Mu50:
    SAV1688 (coaE)
    MW2:
    MW1631 (coaE)
    RF122:
    SAB1547c (coaE)
    ST398:
    SAPIG1742 (coaE)
    T0131:
    SAT0131_01790
    TCH60:
    HMPREF0772_11463 (coaE)
    TW20:
    SATW20_16780 (coaE)
    USA300_TCH1516:
    USA300HOU_1675 (coaE)
    VC40:
    SAVC_07645 (coaE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKVIGLTGGIASGKSTVSELLSVFGFKVVDADKAAREAVKKGSKGLAQVREVFGDEAID
    N315            MPKVIGLTGGIASGKSTVSELLSVFGFKVVDADKAAREAVKKGSKGLAQVREVFGDEAID
    NCTC8325        MPKVIGLTGGIASGKSTVSELLSVFGFKVVDADKAAREAVKKGSKGLAQVREVFGDEAID
    Newman          MPKVIGLTGGIASGKSTVSELLSVFGFKVVDADKAAREAVKKGSKGLAQVREVFGDEAID
    USA300_FPR3757  MPKVIGLTGGIASGKSTVSELLSVFGFKVVDADKAAREAVKKGSKGLAQVREVFGDEAID
                    ************************************************************

    COL             ENGEMNRRYMGDLVFNHPEKRLELNAIIHPIVRDIMEEEKQEYLKQGYNVIMDIPLLFEN
    N315            ENGEMNRRYMGDLVFNHPEKRLELNAIIHPIVRDIMEEEKQEYLKQGYNVIMDIPLLFEN
    NCTC8325        ENGEMNRRYMGDLVFNHPEKRLELNAIIHPIVRDIMEEEKQEYLKQGYNVIMDIPLLFEN
    Newman          ENGEMNRRYMGDLVFNHPEKRLELNAIIHPIVRDIMEEEKQEYLKQGYNVIMDIPLLFEN
    USA300_FPR3757  ENGEMNRRYMGDLVFNHPEKRLELNAIIHPIVRDIMEEEKQEYLKQGYNVIMDIPLLFEN
                    ************************************************************

    COL             ELENTVDEVWVVYTSESIQMDRLMQRNNLSLEDAKARVYSQISIDKKSRMADHVIDNLGD
    N315            ELENTVDEVWVVYTSESIQMDRLMQRNNLSLEDAKARVYSQISIDKKSRMADHVIDNLGD
    NCTC8325        ELENAVDEVWVVYTSESIQMDRLMQRNNLSLEDAKARVYSQISIDKKSRMADHVIDNLGD
    Newman          ELENTVDEVWVVYTSESIQMDRLMQRNNLSLEDAKARVYSQISIDKKSRMADHVIDNLGD
    USA300_FPR3757  ELENTVDEVWVVYTSESIQMDRLMQRNNLSLEDAKARVYSQISIDKKSRMADHVIDNLGD
                    ****:*******************************************************

    COL             KLELKQNLERLLEEEGYIEKPNYGEED
    N315            KLELKQNLERLLEEEGYIEKPNYGEED
    NCTC8325        KLELKQNLERLLEEEGYIEKPNYGEED
    Newman          KLELKQNLERLLEEEGYIEKPNYGEED
    USA300_FPR3757  KLELKQNLERLLEEEGYIEKPNYGEED
                    ***************************