From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004313000
  • symbol?: polA
  • description?: DNA polymerase I

      descriptions from strain specific annotations:

    • DNA polymerase I
    • DNA polymerase I superfamily protein
    • DNA-directed DNA polymerase I
    • DNA polymerase I (POL I)
  • strand?: -
  • coordinates?: 4552587..4555217
  • synteny block?: BlockID0033370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1737 (polA)
    N315:
    SA1513 (polA)
    NCTC8325:
    Newman:
    NWMN_1583 (polA)
    USA300_FPR3757:
    04-02981:
    SA2981_1649 (polA)
    08BA02176:
    C248_1732 (polA)
    11819-97:
    MS7_1697 (polA)
    71193:
    ST398NM01_1744
    ECT-R 2:
    ECTR2_1530 (polA)
    ED133:
    SAOV_1678
    ED98:
    SAAV_1680 (polA)
    HO 5096 0412:
    SAEMRSA15_16000 (polA)
    JH1:
    SaurJH1_1781
    JH9:
    SaurJH9_1747
    JKD6008:
    SAA6008_01657 (polA)
    JKD6159:
    SAA6159_01614
    LGA251:
    SARLGA251_15820 (polA)
    M013:
    M013TW_1703
    MRSA252:
    SAR1769 (polA)
    MSHR1132:
    SAMSHR1132_15210
    MSSA476:
    SAS1618
    Mu3:
    SAHV_1676 (polA)
    Mu50:
    SAV1690 (polA)
    MW2:
    MW1633 (polA)
    RF122:
    SAB1549c (polA)
    ST398:
    SAPIG1744
    T0131:
    SAT0131_01792
    TCH60:
    HMPREF0772_11461 (polA)
    TW20:
    SATW20_16800 (polA)
    USA300_TCH1516:
    USA300HOU_1677 (polA)
    VC40:
    SAVC_07655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKLVLIDGNSLSFRAFYALPLLSNKAGIHTNAVYGFAMLLEKILKEEKPNHFLVAFDAG
    N315            MNKLVLIDGNSLSFRAFYALPLLSNKAGIHTNAVYGFAMLLEKILKEEKPNHFLVAFDAG
    NCTC8325        MNKLVLIDGNSLSFRAFYALPLLSNKAGIHTNAVYGFAMLLEKILKEEKPNHFLVAFDAG
    Newman          MNKLVLIDGNSLSFRAFYALPLLSNKAGIHTNAVYGFAMLLEKILKEEKPNHFLVAFDAG
    USA300_FPR3757  MNKLVLIDGNSLSFRAFYALPLLSNKAGIHTNAVYGFAMLLEKILKEEKPNHFLVAFDAG
                    ************************************************************

    COL             KTTFRHEKYSEYKGGRQKTPPELSEQFPYIRQLLDAYHIKRYELDNYEADDIIGTLSKEA
    N315            KTTFRHEKYSEYKGGRQKTPPELSEQFPYIRQLLDAYHIKRYELDNYEADDIIGTLSKEA
    NCTC8325        KTTFRHEKYSEYKGGRQKTPPELSEQFPYIRQLLDAYHIKRYELDNYEADDIIGTLSKEA
    Newman          KTTFRHEKYSEYKGGRQKTPPELSEQFPYIRQLLDAYHIKRYELDNYEADDIIGTLSKEA
    USA300_FPR3757  KTTFRHEKYSEYKGGRQKTPPELSEQFPYIRQLLDAYHIKRYELDNYEADDIIGTLSKEA
                    ************************************************************

    COL             DKAGFQTIIITGDRDLTQLATDNVTIYYTKKGVTDVDHYTPDFIAEKYNGLTPNQIIDMK
    N315            DKAGFQTIIITGDRDLTQLATDNVTIYYTKKGVTDVDHYTPDFIAEKYNGLTPNQIIDMK
    NCTC8325        DKAGFQTIIITGDRDLTQLATDNVTIYYTKKGVTDVDHYTPDFIAEKYNGLTPNQIIDMK
    Newman          DKAGFQTIIITGDRDLTQLATDNVTIYYTKKGVTDVDHYTPDFIAEKYNGLTPNQIIDMK
    USA300_FPR3757  DKAGFQTIIITGDRDLTQLATDNVTIYYTKKGVTDVDHYTPDFIAEKYNGLTPNQIIDMK
                    ************************************************************

    COL             GLMGDTSDNIPGVAGVGEKTAIKLLNQFDTVEGVYEHLDEISGKKLKEKLQNSKEDALMS
    N315            GLMGDTSDNIPGVAGVGEKTAIKLLNQFDTVEGVYEHLDEISGKKLKEKLQNSKEDALMS
    NCTC8325        GLMGDTSDNIPGVAGVGEKTAIKLLNQFDTVEGVYEHLDEISGKKLKEKLQNSKEDALMS
    Newman          GLMGDTSDNIPGVAGVGEKTAIKLLNQFDTVEGVYEHLDEISGKKLKEKLQNSKEDALMS
    USA300_FPR3757  GLMGDTSDNIPGVAGVGEKTAIKLLNQFDTVEGVYEHLDEISGKKLKEKLQNSKEDALMS
                    ************************************************************

    COL             KELATINVDSPIEVKLEDTLMTHQDEQQEKIELFKKLEFKQLLADIDQSASVEDAIEKTF
    N315            KELATINVDSPIEVKLEDTLMTHQDEQQEKIELFKKLEFKQLLSDIDQSASVEDAIEKTF
    NCTC8325        KELATINVDSPIEVKLEDTLMTHQDEQQEKIELFKKLEFKQLLADIDQSASVEDAIEKTF
    Newman          KELATINVDSPIEVKLEDTLMTHQDEQQEKIELFKKLEFKQLLADIDQSASVEDAIEKTF
    USA300_FPR3757  KELATINVDSPIEVKLEDTLMTHQDEQQEKIELFKKLEFKQLLADIDQSASVEDAIEKTF
                    *******************************************:****************

    COL             EIETSFDNIDFTSLKEAAIHFELDGGNYLRNNILKFSLFTGEKHIVINADDINNYVELVS
    N315            EIETSFDNIDFTSLKEAAIHFELDGGNYLRNNILKFSLFTGEKHIVINADDINNYAELVS
    NCTC8325        EIETSFDNIDFTSLKEAAIHFELDGGNYLRNNILKFSLFTGEKHIVINADDINNYVELVS
    Newman          EIETSFDNIDFTSLKEAAIHFELDGGNYLRNNILKFSLFTGEKHIVINADDINNYVELVS
    USA300_FPR3757  EIETSFDNIDFTSLKEAAIHFELDGGNYLRNNILKFSLFTGEKHIVINADDINNYVELVS
                    *******************************************************.****

    COL             WLENPNSKKVVYDAKKTYVASHRLGIDIQNISFDIMLASYIIDPSRTISDVQSVVSLYGQ
    N315            WLENPNTKKVVYDAKKTYVASHRLGIDIQNISFDIMLASYIIDPSRTISDVQSVVSLYGQ
    NCTC8325        WLENPNSKKVVYDAKKTYVASHRLGIDIQNISFDIMLASYIIDPSRTISDVQSVVSLYGQ
    Newman          WLENPNSKKVVYDAKKTYVASHRLGIDIQNISFDIMLASYIIDPSRTISDVQSVVSLYGQ
    USA300_FPR3757  WLENPNSKKVVYDAKKTYVASHRLGIDIQNISFDIMLASYIIDPSRTISDVQSVVSLYGQ
                    ******:*****************************************************

    COL             SFVKDDVSIYGKGKKFKVPEDDVLNPYVASITDAIYFAKPNMDKQLEEYNQVELLADLEL
    N315            SFVKDDVSIYGKGKKFKVPEDDVLNPYVASITDAIYFAKPNMDKQLEEYNQVELLADLEL
    NCTC8325        SFVKDDVSIYGKGKKFKVPEDDVLNPYVASITDAIYFAKPNMDKQLEEYNQVELLADLEL
    Newman          SFVKDDVSIYGKGKKFKVPEDDVLNPYVASITDAIYFAKPNMDKQLEEYNQVELLADLEL
    USA300_FPR3757  SFVKDDVSIYGKGKKFKVPEDDVLNPYVASITDAIYFAKPNMDKQLEEYNQVELLADLEL
                    ************************************************************

    COL             PLAKILSEMEEIGIFTDVHDLEEMEKEIQEKLDVLIRNIHDAAGEDFNINSPKQLGVVLF
    N315            PLAKILSEMEEIGIFTDVHDLEEMEKEIQEKLDVLIRNIHDAAGEDFNINSPKQLGVVLF
    NCTC8325        PLAKILSEMEEIGIFTDVHDLEEMEKEIQEKLDVLIRNIHDAAGEDFNINSPKQLGVVLF
    Newman          PLAKILSEMEEIGIFTDVHDLEEMEKEIQEKLDVLIRNIHDAAGEDFNINSPKQLGVVLF
    USA300_FPR3757  PLAKILSEMEEIGIFTDVHDLEEMEKEIQEKLDVLIRNIHDAAGEDFNINSPKQLGVVLF
                    ************************************************************

    COL             ETLQLPVIKKTKTGYSTAVDVLEQLQGEHPIIDYILEYRQLSKLQSTYVEGLQKVISDDQ
    N315            ETLQLPVIKKTKTGYSTAVDVLEQLQGEHPIIDYILEYRQLSKLQSTYVEGLQKVISDDQ
    NCTC8325        ETLQLPVIKKTKTGYSTAVDVLEQLQGEHPIIDYILEYRQLSKLQSTYVEGLQKVISDDQ
    Newman          ETLQLPVIKKTKTGYSTAVDVLEQLQGEHPIIDYILEYRQLSKLQSTYVEGLQKVISDDQ
    USA300_FPR3757  ETLQLPVIKKTKTGYSTAVDVLEQLQGEHPIIDYILEYRQLSKLQSTYVEGLQKVISDDQ
                    ************************************************************

    COL             RIHTRFNQTLAQTGRLSSVDPNLQNIPVRLEEGRKIRKAFKPTSKDSVILSADYSQIELR
    N315            RIHTRFNQTLAQTGRLSSVDPNLQNIPVRLEEGRKIRKAFKPTSKDSVILSADYSQIELR
    NCTC8325        RIHTRFNQTLAQTGRLSSVDPNLQNIPVRLEEGRKIRKAFKPTSKDSVILSADYSQIELR
    Newman          RIHTRFNQTLAQTGRLSSVDPNLQNIPVRLEEGRKIRKAFKPTSKDSVILSADYSQIELR
    USA300_FPR3757  RIHTRFNQTLAQTGRLSSVDPNLQNIPVRLEEGRKIRKAFKPTSKDSVILSADYSQIELR
                    ************************************************************

    COL             VLAHITQDESMKEAFINGDDIHTATAMKVFGVEADQVDSLMRRQAKAVNFGIVYGISDYG
    N315            VLAHITQDESMKEAFINGDDIHTATAMKVFGVEADQVDSLMRRQAKAVNFGIVYGISDYG
    NCTC8325        VLAHITQDESMKEAFINGDDIHTATAMKVFGVEADQVDSLMRRQAKAVNFGIVYGISDYG
    Newman          VLAHITQDESMKEAFINGDDIHTATAMKVFGVEADQVDSLMRRQAKAVNFGIVYGISDYG
    USA300_FPR3757  VLAHITQDESMKEAFINGDDIHTATAMKVFGVEADQVDSLMRRQAKAVNFGIVYGISDYG
                    ************************************************************

    COL             LSQSLGITRKKAKAFIDDYLASFPGVKQYMSDIVKDAKALGYVETLLHRRRYIPDITSRN
    N315            LSQSLGITRKKAKAFIDDYLASFPGVKQYMSDIVKDAKALGYVETLLHRRRYIPDITSRN
    NCTC8325        LSQSLGITRKKAKAFIDDYLASFPGVKQYMSDIVKDAKALGYVETLLHRRRYIPDITSRN
    Newman          LSQSLGITRKKAKAFIDDYLASFPGVKQYMSDIVKDAKALGYVETLLHRRRYIPDITSRN
    USA300_FPR3757  LSQSLGITRKKAKAFIDDYLASFPGVKQYMSDIVKDAKALGYVETLLHRRRYIPDITSRN
                    ************************************************************

    COL             FNLRGFAERTAMNTPIQGSAADIIKLAMVKFAQKMKETTYQAKLLLQVHDELIFEVPKSE
    N315            FNLRGFAERTAMNTPIQGSAADIIKLAMVKFAQKMKETTYQAKLLLQVHDELIFEVPKSE
    NCTC8325        FNLRGFAERTAMNTPIQGSAADIIKLAMVKFAQKMKETTYQAKLLLQVHDELIFEVPKSE
    Newman          FNLRGFAERTAMNTPIQGSAADIIKLAMVKFAQKMKETTYQAKLLLQVHDELIFEVPKSE
    USA300_FPR3757  FNLRGFAERTAMNTPIQGSAADIIKLAMVKFAQKMKETTYQAKLLLQVHDELIFEVPKSE
                    ************************************************************

    COL             VDSFSEFVEEIMENALQLDVPLKVDSSYGATWYDAK
    N315            VDSFSEFVEEIMENALQLDVPLKVDSSYGATWYDAK
    NCTC8325        VDSFSEFVEEIMENALQLDVPLKVDSSYGATWYDAK
    Newman          VDSFSEFVEEIMENALQLDVPLKVDSSYGATWYDAK
    USA300_FPR3757  VDSFSEFVEEIMENALQLDVPLKVDSSYGATWYDAK
                    ************************************