From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004317000
  • symbol?: phoP
  • description?: alkaline phosphatase synthesis transcriptional regulatory protein

      descriptions from strain specific annotations:

    • alkaline phosphatase synthesis transcriptional regulatory protein
    • DNA-binding response regulator
    • alkaline phosphatase synthesis transcriptional regulatory proteinphoP
    • PhoP protein
    • response regulator OmpR
    • two component transcriptional regulator
    • Two component transcriptional regulator, winged helix family
  • strand?: -
  • coordinates?: 4559328..4560032
  • synteny block?: BlockID0033410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1740 (phoP)
    N315:
    SA1516 (phoP)
    NCTC8325:
    Newman:
    NWMN_1586 (phoP)
    USA300_FPR3757:
    04-02981:
    SA2981_1652 (phoP)
    08BA02176:
    C248_1735 (phoP)
    11819-97:
    MS7_1700 (phoP)
    71193:
    ST398NM01_1747
    ECT-R 2:
    ECTR2_1533
    ED133:
    SAOV_1681 (phoP)
    ED98:
    SAAV_1683 (phoP)
    HO 5096 0412:
    SAEMRSA15_16030 (phoP)
    JH1:
    SaurJH1_1784
    JH9:
    SaurJH9_1750
    JKD6008:
    SAA6008_01660 (ompR)
    JKD6159:
    SAA6159_01617 (ompR)
    LGA251:
    SARLGA251_15850 (phoP)
    M013:
    M013TW_1706
    MRSA252:
    SAR1772 (phoP)
    MSHR1132:
    SAMSHR1132_15440
    MSSA476:
    SAS1621
    Mu3:
    SAHV_1679 (phoP)
    Mu50:
    SAV1693 (phoP)
    MW2:
    MW1637 (phoP)
    RF122:
    SAB1552c (phoP)
    ST398:
    SAPIG1747
    T0131:
    SAT0131_01795
    TCH60:
    HMPREF0772_11458 (phoP)
    TW20:
    SATW20_16830 (phoP)
    USA300_TCH1516:
    USA300HOU_1680
    VC40:
    SAVC_07670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD
    N315            MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD
    NCTC8325        MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD
    Newman          MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD
    USA300_FPR3757  MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD
                    ************************************************************

    COL             GIDVCKTVRTNKNLVPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
    N315            GIDVCKTVRTNKNLVPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
    NCTC8325        GIDVCKTVRTNKNLVPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
    Newman          GIDVCKTVRTNKNLVPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
    USA300_FPR3757  GIDVCKTVRTNKNLVPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
                    ************************************************************

    COL             SQFVKEVEEIDDDITIGSIRIRPDYFEVYKHNELLELTPKEFELLLYLIERQGRVITREH
    N315            SQFVKEVEEIDDDITIGSIRIRPDYFEVYKHNELLELTPKEFELLLYLIERQGRVITREH
    NCTC8325        SQFVKEVEEIDDDITIGSIRIRPDYFEVYKHNELLELTPKEFELLLYLIERQGRVITREH
    Newman          SQFVKEVEEIDDDITIGSIRIRPDYFEVYKHNELLELTPKEFELLLYLIERQGRVITREH
    USA300_FPR3757  SQFVKEVEEIDDDITIGSIRIRPDYFEVYKHNELLELTPKEFELLLYLIERQGRVITREH
                    ************************************************************

    COL             MLNTVWNYEFAGDSRIVDVHISHLRDKLEDNPKKPQLIKTVRGLGYKLERPKEQ
    N315            MLNTVWNYEFAGDSRIVDVHISHLRDKLEDNPKKPQLIKTVRGLGYKLERPKEQ
    NCTC8325        MLNTVWNYEFAGDSRIVDVHISHLRDKLEDNPKKPQLIKTVRGLGYKLERPKEQ
    Newman          MLNTVWNYEFAGDSRIVDVHISHLRDKLEDNPKKPQLIKTVRGLGYKLERPKEQ
    USA300_FPR3757  MLNTVWNYEFAGDSRIVDVHISHLRDKLEDNPKKPQLIKTVRGLGYKLERPKEQ
                    ******************************************************