From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004351000
  • symbol?: dnaE
  • description?: DNA polymerase III subunit alpha

      descriptions from strain specific annotations:

    • DNA polymerase III subunit alpha
    • DNA polymerase III, alpha subunit
    • DNA polymerase III subunit alpha superfamily protein
    • DNA-directed DNA polymerase III alpha subunit
    • DNA-directed DNA polymerase III subunit alpha
    • DNA polymerase III, alpha chain
    • DNA polymerase III alpha subunit
    • DNA polymerase III DnaE
  • strand?: -
  • coordinates?: 4590703..4593900
  • synteny block?: BlockID0033560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1750 (dnaE)
    N315:
    SA1525 (dnaE)
    NCTC8325:
    Newman:
    NWMN_1597 (dnaE)
    USA300_FPR3757:
    04-02981:
    SA2981_1661 (dnaE)
    08BA02176:
    C248_1744 (dnaE)
    11819-97:
    MS7_1709 (dnaE)
    71193:
    ST398NM01_1756
    ECT-R 2:
    ECTR2_1543 (dnaE)
    ED133:
    SAOV_1690 (dnaE)
    ED98:
    SAAV_1712 (dnaE)
    HO 5096 0412:
    SAEMRSA15_16120 (dnaE)
    JH1:
    SaurJH1_1793
    JH9:
    SaurJH9_1759
    JKD6008:
    SAA6008_01671 (dnaE)
    JKD6159:
    SAA6159_01626 (dnaE)
    LGA251:
    SARLGA251_15940 (dnaE)
    M013:
    M013TW_1715
    MRSA252:
    SAR1781 (dnaE)
    MSHR1132:
    SAMSHR1132_15530
    MSSA476:
    SAS1630
    Mu3:
    SAHV_1689 (dnaE)
    Mu50:
    SAV1703 (dnaE)
    MW2:
    MW1646 (dnaE)
    RF122:
    SAB1561c (dnaE)
    ST398:
    SAPIG1756
    T0131:
    SAT0131_01806
    TCH60:
    HMPREF0772_11449 (dnaE)
    TW20:
    SATW20_16940 (dnaE)
    USA300_TCH1516:
    USA300HOU_1689 (dnaE2)
    VC40:
    SAVC_07725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVAYLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKP
    N315            MVAYLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKP
    NCTC8325        MVAYLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKP
    Newman          MVAYLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKP
    USA300_FPR3757  MVAYLNIHTAYDLLNSSLKIEDAVRLAVSENVDALAITDTNVLYGFPKFYDACIANNIKP
                    ************************************************************

    COL             IFGMTIYVTNGLNTVETVVLAKNNDGLKDLYQLSSEIKMNALEHVSFELLKRFSNNMIII
    N315            IFGMTIYVTNGLNTVETVVLAKNNDGLKDLYQLSSEIKMNSMENVSFELLQQFSSNLIII
    NCTC8325        IFGMTIYVTNGLNTVETVVLAKNNDGLKDLYQLSSEIKMNALEHVSFELLKRFSNNMIII
    Newman          IFGMTIYVTNGLNTVETVVLAKNNDGLKDLYQLSSEIKMNALEHVSFELLKRFSNNMIII
    USA300_FPR3757  IFGMTIYVTNGLNTVETVVLAKNNDGLKDLYQLSSEIKMNALEHVSFELLKRFSNNMIII
                    ****************************************::*:******::**.*:***

    COL             FKKVGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWIQNVCYQTRQDADTISALAAIRD
    N315            FKNVADEHRDIVQVFDSHEDTYLDHQSVLVQGIKHVWIQNVCYQTRQDADTISALAAIRD
    NCTC8325        FKKVGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWIQNVCYQTRQDADTISALAAIRD
    Newman          FKKVGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWIQNVCYQTRQDADTISALAAIRD
    USA300_FPR3757  FKKVGDQHRDIVQVFETHNDTYMDHLSISIQGRKHVWIQNVCYQTRQDADTISALAAIRD
                    **:*.*:********::*:***:** *: :** ***************************

    COL             NTKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDVIAQKCDAELKYHQSLLPQYETP
    N315            NAKLDLIHDQEDFGAHFLTEKEIKQLDINQEYLTQVDVIAQKCNAELKYHQSLLPQYQTP
    NCTC8325        NTKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDVIAQKCDAELKYHQSLLPQYETP
    Newman          NTKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDVIAQKCDAELKYHQSLLPQYETP
    USA300_FPR3757  NTKLDLIHDQEDFGAHFLTEKEINQLDINQEYLTQVDVIAQKCDAELKYHQSLLPQYETP
                    *:*********************:*******************:*************:**

    COL             NDESAKKYLWRVLVTQLKKLELNYDVYLERLKYEYKVITNMGFEDYFLIVSDLIHYAKTN
    N315            NDESAKKYLWRVLVTQLKKLELNYDVYLERLKYEYKVITNMGFEDYFLIVSDLIHYAKTN
    NCTC8325        NDESAKKYLWRVLVTQLKKLELNYDVYLERLKYEYKVITNMGFEDYFLIVSDLIHYAKTN
    Newman          NDESAKKYLWRVLVTQLKKLELNYDVYLERLKYEYKVITNMGFEDYFLIVSDLIHYAKTN
    USA300_FPR3757  NDESAKKYLWRVLVTQLKKLELNYDVYLERLKYEYKVITNMGFEDYFLIVSDLIHYAKTN
                    ************************************************************

    COL             DVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERV
    N315            DVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERV
    NCTC8325        DVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERV
    Newman          DVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERV
    USA300_FPR3757  DVMVGPGRGSSAGSLVSYLLGITTIDPIKFNLLFERFLNPERVTMPDIDIDFEDTRRERV
                    ************************************************************

    COL             IQYVQEKYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKLGITLDEA
    N315            IQYVQEKYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKLGITLDEA
    NCTC8325        IQYVQEKYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKLGITLDEA
    Newman          IQYVQEKYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKLGITLDEA
    USA300_FPR3757  IQYVQEKYGELHVSGIVTFGHLLARAVARDVGRIMGFDEVTLNEISSLIPHKLGITLDEA
                    ************************************************************

    COL             YQIDDFKKFVHRNHRHERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTGL
    N315            YQIDDFKKFVHRNHRHERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTGL
    NCTC8325        YQIDDFKEFVHRNHRHERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTGL
    Newman          YQIDDFKKFVHRNHRHERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTGL
    USA300_FPR3757  YQIDDFKKFVHRNHRHERWFSICKKLEGLPRHTSTHAAGIIINDHPLYEYAPLTKGDTGL
                    *******:****************************************************

    COL             LTQWTMTEAERIGLLKIDFLGLRNLSIIHQILTQVKKDLGINIDIEKIPFDDQKVFELLS
    N315            LTQWTMTEAERIGLLKIDFLGLRNLSIIHQILIQVKKDLGINIDIEKIPFDDQKVFELLS
    NCTC8325        LTQWTMTEAERIGLLKIDFLGLRNLSIIHQILTQVKKDLGINIDIEKIPFDDQKVFELLS
    Newman          LTQWTMTEAERIGLLKIDFLGLRNLSIIHQILTQVKKDLGINIDIEKIPFDDQKVFELLS
    USA300_FPR3757  LTQWTMTEAERIGLLKIDFLGLRNLSIIHQILTQVKKDLGINIDIEKIPFDDQKVFELLS
                    ******************************** ***************************

    COL             QGDTTGIFQLESDGVRSVLKKLKPEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQY
    N315            QGDTTGIFQLESDGVRSVLKKLKPEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQY
    NCTC8325        QGDTTGIFQLESDGVRSVLKKLKPEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQY
    Newman          QGDTTGIFQLESDGVRSVLKKLKPEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQY
    USA300_FPR3757  QGDTTGIFQLESDGVRSVLKKLKPEHFEDIVAVTSLYRPGPMEEIPTYITRRHDPSKVQY
                    ************************************************************

    COL             LHPHLEPILKNTYGVIIYQEQIMQIASTFANFSYGEADILRRAMSKKNRAVLESERQHFI
    N315            LHPHLEPILKNTYGVIIYQEQIMQIASTFANFSYGEADILRRAMSKKNRAVLESERQHFI
    NCTC8325        LHPHLEPILKNTYGVIIYQEQIMQIASTFANFSYGEADILRRAMSKKNRAVLESERQHFI
    Newman          LHPHLEPILKNTYGVIIYQEQIMQIASTFANFSYGEADILRRAMSKKNRAVLESERQHFI
    USA300_FPR3757  LHPHLEPILKNTYGVIIYQEQIMQIASTFANFSYGEADILRRAMSKKNRAVLESERQHFI
                    ************************************************************

    COL             EGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIMSFLKVHYPNYFYANILS
    N315            EGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIMSFLKVHYPNYFYANILS
    NCTC8325        EGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIMSFLKVHYPNYFYANILS
    Newman          EGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIMSFLKVHYPNYFYANILS
    USA300_FPR3757  EGAKQNGYHEDISKQIFDLILKFADYGFPRAHAVSYSKIAYIMSFLKVHYPNYFYANILS
                    ************************************************************

    COL             NVIGSEKKTAQMIEEAKKQGITILPPNINESHWFYKPSQEGIYLSIGTIKGVGYQSVKVI
    N315            NVIGSEKKTAQMIEEAKKQGITILPPNINESHWFYKPSQEGIYLSIGTIKGVGYQSVKVI
    NCTC8325        NVIGSEKKTAQMIEEAKKQGITILPPNINESHWFYKPSQEGIYLSIGTIKGVGYQSVKVI
    Newman          NVIGSEKKTAQMIEEAKKQGITILPPNINESHWFYKPSQEGIYLSIGTIKGVGYQSVKVI
    USA300_FPR3757  NVIGSEKKTAQMIEEAKKQGITILPPNINESHWFYKPSQEGIYLSIGTIKGVGYQSVKVI
                    ************************************************************

    COL             VDERYQNGKFKDFFDFARRIPKRVKTRKLLEALILVGAFDAFGKTRSTLLQAIDQVLDGD
    N315            VDERYQNGKFKDFFDFARRIPKRVKTRKLLEALILVGAFDAFGKTRSTLLQAIDQVLDGD
    NCTC8325        VDERYQNGKFKDFFDFARRIPKRVKTRKLLEALILVGAFDAFGKTRSTLLQAIDQVLDGD
    Newman          VDERYQNGKFKDFFDFARRIPKRVKTRKLLEALILVGAFDAFGKTRSTLLQAIDQVLDGD
    USA300_FPR3757  VDERYQNGKFKDFFDFARRIPKRVKTRKLLEALILVGAFDAFGKTRSTLLQAIDQVLDGD
                    ************************************************************

    COL             LNIEQDGFLFDILTPKQMYEDKEELPDALISQYEKEYLGFYVSQHPVDKKFVAKQYLTIF
    N315            LNIEQDGFLFDILTPKQMYEDKEELPDALISQYEKEYLGFYVSQHPVDKKFVAKQYLTIF
    NCTC8325        LNIEQDGFLFDILTPKQMYEDKEELPDALISQYEKEYLGFYVSQHPVDKKFVAKQYLTIF
    Newman          LNIEQDGFLFDILTPKQMYEDKEELPDALISQYEKEYLGFYVSQHPVDKKFVAKQYLTIF
    USA300_FPR3757  LNIEQDGFLFDILTPKQMYEDKEELPDALISQYEKEYLGFYVSQHPVDKKFVAKQYLTIF
                    ************************************************************

    COL             KLSNAQNYKPILVQFDKVKQIRTKNGQNMAFVTLNDGIETLDGVIFPNQFKKYEELLSHN
    N315            KLSNAQNYKPILVQFDKVKQIRTKNGQNMAFVTLNDGIETLDGVIFPNQFKKYEELLSHN
    NCTC8325        KLSNAQNYKPILVQFDKVKQIRTKNGQNMAFVTLNDGIETLDGVIFPNQFKKYEELLSHN
    Newman          KLSNAQNYKPILVQFDKVKQIRTKNGQNMAFVTLNDGIETLDGVIFPNQFKKYEELLSHN
    USA300_FPR3757  KLSNAQNYKPILVQFDKVKQIRTKNGQNMAFVTLNDGIETLDGVIFPNQFKKYEELLSHN
                    ************************************************************

    COL             DLFIVSGKFDHRKQQRQLIINEIQTLATFEEQKLAFAKQIIIRNKSQIDMFEEMIKATKE
    N315            DLFIVSGKFDHRKQQRQLIINEIQTLATFEEQKLAFAKQIIIRNKSQIDMFEEMIKATKE
    NCTC8325        DLFIVSGKFDHRKQQRQLIINEIQTLATFEEQKLAFAKQIIIRNKSQIDMFEEMIKATKE
    Newman          DLFIVSGKFDHRKQQRQLIINEIQTLATFEEQKLAFAKQIIIRNKSQIDMFEEMIKATKE
    USA300_FPR3757  DLFIVSGKFDHRKQQRQLIINEIQTLATFEEQKLAFAKQIIIRNKSQIDMFEEMIKATKE
                    ************************************************************

    COL             NANDVVLSFYDETIKQMTTLGYINQKDSMFNNFIQSFNPSDIRLI
    N315            NANDVVLSFYDETIKQMTTLGYINQKDSMFNNFIQSFNPSDIRLI
    NCTC8325        NANDVVLSFYDETIKQMTTLGYINQKDSMFNNFIQSFNPSDIRLI
    Newman          NANDVVLSFYDETIKQMTTLGYINQKDSMFNNFIQSFNPSDIRLI
    USA300_FPR3757  NANDVVLSFYDETIKQMTTLGYINQKDSMFNNFIQSFNPSDIRLI
                    *********************************************