From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004352000
  • symbol?:
  • description?: bifunctional oligoribonuclease/PAP phosphatase NrnA

      descriptions from strain specific annotations:

    • bifunctional oligoribonuclease/PAP phosphatase NrnA
    • Phosphoesterase, DHH family protein
    • DHH/DHHA1 domain protein
    • DHHA1 domain protein
    • DHH family phosphoesterase
    • exopolyphosphatase-like protein
    • phosphoesterase domain-containing protein
    • RecJ-like phosphoesterase
  • strand?: -
  • coordinates?: 4593921..4594862
  • synteny block?: BlockID0033570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1662
    08BA02176:
    C248_1745
    11819-97:
    MS7_1710
    71193:
    ST398NM01_1757
    ECT-R 2:
    ECTR2_1544
    ED133:
    SAOV_1691
    ED98:
    SAAV_1713
    HO 5096 0412:
    SAEMRSA15_16130
    JH1:
    SaurJH1_1794
    JH9:
    SaurJH9_1760
    JKD6008:
    SAA6008_01672
    JKD6159:
    SAA6159_01627
    LGA251:
    SARLGA251_15950
    M013:
    M013TW_1716
    MRSA252:
    SAR1782
    MSHR1132:
    SAMSHR1132_15540
    MSSA476:
    SAS1631
    Mu3:
    SAHV_1690
    Mu50:
    SAV1704
    MW2:
    MW1647
    RF122:
    SAB1562c
    ST398:
    SAPIG1757
    T0131:
    SAT0131_01807
    TCH60:
    HMPREF0772_11448
    TW20:
    SATW20_16950
    USA300_TCH1516:
    USA300HOU_1690
    VC40:
    SAVC_07730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISTLNEIMKCIEDNDTIIIHRHVRPDPDAYGSQLGLKYYIQQKFPQKQVFAVGEAESSL
    N315            MISTLNEIMKCIEDNDTIIIHRHVRPDPDAYGSQLGLKYYIQQKFPQKQVFAVGEAESSL
    NCTC8325        MISTLNEIMKCIEDNDTIIIHRHVRPDPDAYGSQLGLKYYIQQKFPQKQVFAVGEAESSL
    Newman          MISTLNEIMKCIEDNDTIIIHRHVRPDPDAYGSQLGLKYYIQQKFPQKQVFAVGEAESSL
    USA300_FPR3757  MISTLNEIMKCIEDNDTIIIHRHVRPDPDAYGSQLGLKYYIQQKFPQKQVFAVGEAESSL
                    ************************************************************

    COL             SFIGELDNIDDKTYQDALVIVCDTANAPRIDDERYSTGRKLIKIDHHPAVDQYGDINLVN
    N315            SFIGELDNIDDKTYQDALVIVCDTANAPRIDDERYSTGSKLIKIDHHPAVDQYGDINLVN
    NCTC8325        SFIGELDNIDDKTYQDALVIVCDTANAPRIDDERYSTGRKLIKIDHHPAVDQYGDINLVN
    Newman          SFIGELDNIDDKTYQDALVIVCDTANAPRIDDERYSTGRKLIKIDHHPAVDQYGDINLVN
    USA300_FPR3757  SFIGELDNIDDKTYQDALVIVCDTANAPRIDDERYSTGRKLIKIDHHPAVDQYGDINLVN
                    ************************************** *********************

    COL             TNASSTSEIIYDLISHFNDEAIVNKDIASVLYLGIVGDTGRFLFNNTSEHTMEIAGKLIG
    N315            TNASSTSEIIYDLISHFNDEAIVNKDIASVLYLGIVGDTGRFLFNNTSEHTMEIAGKLIG
    NCTC8325        TNASSTSEIIYDLISHFNDEAIVNKDIASVLYLGIVGDTGRFLFNNTSEHTMEIAGKLIG
    Newman          TNASSTSEIIYDLISHFNDEAIVNKDIASVLYLGIVGDTGRFLFNNTSEHTMEIAGKLIG
    USA300_FPR3757  TNASSTSEIIYDLISHFNDEAIVNKDIASVLYLGIVGDTGRFLFNNTSEHTMEIAGKLIG
                    ************************************************************

    COL             HDIDHNALLNKMMEKDPKMLPFQGYVLQHFELMDDGFCQVKITEDVLEQFGIQPNEASQF
    N315            HDIDHNALLNKMMEKDPKMLPFQGYVLQHFELMDDGFCQVKITEDVLEQFGIQPNEASQF
    NCTC8325        HDIDHNALLNKMMEKDPKMLPFQGYVLQHFELMDDGFCQVKITEDVLEQFGIQPNEASQF
    Newman          HDIDHNALLNKMMEKDPKMLPFQGYVLQHFELMDDGFCQVKITEDVLEQFGIQPNEASQF
    USA300_FPR3757  HDIDHNALLNKMMEKDPKMLPFQGYVLQHFELMDDGFCQVKITEDVLEQFGIQPNEASQF
                    ************************************************************

    COL             VNTIADIKGLKIWVFAVDEGNEIRCRLRSKGQLIINDIAQDFGGGGHPNASGVSVDSWDE
    N315            VNTIADIKGLKIWVFAVDEGSEIRCRLRSKGQLIINDIAQDFGGGGHPNASGVSVNSWDE
    NCTC8325        VNTIADIKGLKIWVFAVDEGNEIRCRLRSKGQLIINDIAQDFGGGGHPNASGVSVDSWDE
    Newman          VNTIADIKGLKIWVFAVDEGNEIRCRLRSKGQLIINDIAQDFGGGGHPNASGVSVDSWDE
    USA300_FPR3757  VNTIADIKGLKIWVFAVDEGNEIRCRLRSKGQLIINDIAQDFGGGGHPNASGVSVDSWDE
                    ********************.**********************************:****

    COL             FEQLATALRTKLN
    N315            FEQLATALRTKLN
    NCTC8325        FEQLATALRTKLN
    Newman          FEQLATALRTKLN
    USA300_FPR3757  FEQLATALRTKLN
                    *************