From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004355000
  • symbol?: uspA2
  • description?: universal stress protein

      descriptions from strain specific annotations:

    • universal stress protein
    • UspA domain-containing protein
    • universal stress protein family protein
    • putative universal stress protein
    • Universal stress protein family
    • universal stress family protein
    • universal stress protein family, putative
    • transcription factor
  • strand?: +
  • coordinates?: 4597239..4597670
  • synteny block?: BlockID0033600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1664
    08BA02176:
    C248_1747
    11819-97:
    MS7_1712
    71193:
    ST398NM01_1759
    ECT-R 2:
    ECTR2_1546
    ED133:
    SAOV_1693
    ED98:
    SAAV_1715
    HO 5096 0412:
    SAEMRSA15_16150
    JH1:
    SaurJH1_1796
    JH9:
    SaurJH9_1762
    JKD6008:
    SAA6008_01674 (uspA_2)
    JKD6159:
    SAA6159_01629 (uspA_2)
    LGA251:
    SARLGA251_15970
    M013:
    M013TW_1718
    MRSA252:
    SAR1784
    MSHR1132:
    SAMSHR1132_15560
    MSSA476:
    SAS1633
    Mu3:
    SAHV_1692
    Mu50:
    SAV1706
    MW2:
    MW1649
    RF122:
    SAB1564
    ST398:
    SAPIG1759
    T0131:
    SAT0131_01809 (opp1A)
    TCH60:
    HMPREF0772_11446
    TW20:
    SATW20_16970
    USA300_TCH1516:
    USA300HOU_1692
    VC40:
    SAVC_07740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYKNILLGVDTQLKNEKALKEVSKLAGEGTVVTVLNAISEQDAQASIKAGVHLNKLTEER
    N315            MYKNILLGVDTQLKNEKALKEVSKLAGEGTVVTVLNAISEQDAQASIKAGVHLNKLTEER
    NCTC8325        MYKNILLGVDTQLKNEKALKEVSKLAGEGTVVTVLNAISEQDAQASIKAGVHLNKLTEER
    Newman          MYKNILLGVDTQLKNEKALKEVSKLAGEGTVVTVLNAISEQDAQASIKAGVHLNKLTEER
    USA300_FPR3757  MYKNILLGVDTQLKNEKALKEVSKLAGEGTVVTVLNAISEQDAQASIKAGVHLNKLTEER
                    ************************************************************

    COL             SKRLEKTRKALEDYGIDYDQIIVRGNAKEELLKHANSGKYEIVVLSNRKAEDKKKFVLGS
    N315            SKRLEKTRKALEDYGIDYDQIIVRGNAKEELLKHANSGKYEIVVLSNRKAEDKKKFVLGS
    NCTC8325        SKRLEKTRKALEDYGIDYDQIIVRGNAKEELLKHANSGKYEIVVLSNRKAEDKKKFVLGS
    Newman          SKRLEKTRKALEDYGIDYDQIIVRGNAKEELLKHANSGKYEIVVLSNRKAEDKKKFVLGS
    USA300_FPR3757  SKRLEKTRKALEDYGIDYDQIIVRGNAKEELLKHANSGKYEIVVLSNRKAEDKKKFVLGS
                    ************************************************************

    COL             VSHKVAKRATIPVLIVK
    N315            VSHKVAKRATIPVLIVK
    NCTC8325        VSHKVAKRATIPVLIVK
    Newman          VSHKVAKRATIPVLIVK
    USA300_FPR3757  VSHKVAKRATIPVLIVK
                    *****************