From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004359000
  • symbol?: pepQ
  • description?: Xaa-Pro dipeptidase

      descriptions from strain specific annotations:

    • Xaa-Pro dipeptidase
    • peptidase M24
    • Xaa-Pro dipeptidase-like protein
    • proline dipeptidase
    • xaa-Pro dipeptidase (X-Pro dipeptidase) (Prolinedipeptidase) (Prolidase) (Imidodipeptidase)
    • metallopeptidase M24 family protein
    • proline dipeptidase-like protein
    • M24 family Xaa-Pro dipeptidase
    • putative metallopeptidase
    • putative conserved peptidase
  • strand?: +
  • coordinates?: 4599354..4600430
  • synteny block?: BlockID0033640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1756 (pepQ)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1666
    08BA02176:
    C248_1749
    11819-97:
    MS7_1714
    71193:
    ST398NM01_1761
    ECT-R 2:
    ECTR2_1548
    ED133:
    SAOV_1695
    ED98:
    SAAV_1717 (pepQ)
    HO 5096 0412:
    SAEMRSA15_16170
    JH1:
    SaurJH1_1798
    JH9:
    SaurJH9_1764
    JKD6008:
    SAA6008_01676
    JKD6159:
    SAA6159_01632
    LGA251:
    SARLGA251_15990
    M013:
    M013TW_1720
    MRSA252:
    SAR1786
    MSHR1132:
    SAMSHR1132_15580
    MSSA476:
    SAS1635
    Mu3:
    SAHV_1694
    Mu50:
    SAV1708
    MW2:
    MW1651
    RF122:
    SAB1567
    ST398:
    SAPIG1761
    T0131:
    SAT0131_01811
    TCH60:
    HMPREF0772_11444 (pepQ)
    TW20:
    SATW20_16990
    USA300_TCH1516:
    USA300HOU_1694 (pepQ)
    VC40:
    SAVC_07750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MTKISKIIDELNNQQADAAWITTPLNVYYFTGYRSEPHERLFALLIKKDGKQV
    N315            MLRSVYEMTKISKIIDELNNQQADAAWITTPLNVYYFTGYRSEPHERLFALLIKKDGKQV
    NCTC8325        -------MTKISKIIDELNNQQADAAWITTPLNVYYFTGYRSEPHERLFALLIKKDGKQV
    Newman          -------MTKISKIIDELNNQQADAAWITTPLNVYYFTGYRSEPHERLFALLIKKDGKQV
    USA300_FPR3757  -------MTKISKIIDELNNQQADAAWITTPLNVYYFTGYRSEPHERLFALLIKKDGKQV
                           *****************************************************

    COL             LFCPKMEVEEVKASPFTGEIVGYLDTENPFSLYPQTINKLLIESEHLTVARQKQLISGFN
    N315            LFCPKMEVEEVKASPFTGEIVGYLDTENPFSLYPQTINKLLIESEHLTVARQKQLISGFN
    NCTC8325        LFCPKMEVEEVKASPFTGEIVGYLDTENPFSLYPQTINKLLIESEHLTVARQKQLISGFN
    Newman          LFCPKMEVEEVKASPFTGEIVGYLDTENPFSLYPQTINKLLIESEHLTVARQKQLISGFN
    USA300_FPR3757  LFCPKMEVEEVKASPFTGEIVGYLDTENPFSLYPQTINKLLIESEHLTVARQKQLISGFN
                    ************************************************************

    COL             VNSFGDVDLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTECEVVNHIEQT
    N315            VNSFGDVDLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTEREVVNHIEQT
    NCTC8325        VNSFGDVDLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTECEVVNHIEQT
    Newman          VNSFGDVDLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTECEVVNHIEQT
    USA300_FPR3757  VNSFGDVDLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTECEVVNHIEQT
                    ************************************************** *********

    COL             IKQYGVNEMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKF
    N315            IKQYGVNEMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKF
    NCTC8325        IKQYGVNEMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKF
    Newman          IKQYGVNEMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKF
    USA300_FPR3757  IKQYGVNEMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKF
                    ************************************************************

    COL             GEPSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLG
    N315            GEPSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLG
    NCTC8325        GEPSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLG
    Newman          GEPSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLG
    USA300_FPR3757  GEPSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLG
                    ************************************************************

    COL             LQEHEYQDVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK
    N315            LQEHEYQDVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK
    NCTC8325        LQEHEYQDVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK
    Newman          LQEHEYQDVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK
    USA300_FPR3757  LQEHEYQDVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK
                    **********************************************************