From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004363000
  • symbol?: ackA
  • description?: acetate kinase

      descriptions from strain specific annotations:

    • acetate kinase
    • acetate kinase A/propionate kinase 2
  • strand?: -
  • coordinates?: 4602854..4604056
  • synteny block?: BlockID0033680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1760 (ackA)
    N315:
    SA1533 (ackA)
    NCTC8325:
    Newman:
    NWMN_1605 (ackA)
    USA300_FPR3757:
    04-02981:
    SA2981_1669 (ackA)
    08BA02176:
    C248_1752 (ackA)
    11819-97:
    MS7_1717 (ackA)
    71193:
    ST398NM01_1764
    ECT-R 2:
    ECTR2_1551 (ackA)
    ED133:
    SAOV_1698 (ackA)
    ED98:
    SAAV_1721 (ackA)
    HO 5096 0412:
    SAEMRSA15_16200 (ackA)
    JH1:
    SaurJH1_1802
    JH9:
    SaurJH9_1767
    JKD6008:
    SAA6008_01679 (ackA)
    JKD6159:
    SAA6159_01635 (ackA)
    LGA251:
    SARLGA251_16020 (ackA)
    M013:
    M013TW_1724
    MRSA252:
    SAR1789 (ackA)
    MSHR1132:
    SAMSHR1132_15610
    MSSA476:
    SAS1638
    Mu3:
    SAHV_1697 (ackA)
    Mu50:
    SAV1711 (ackA)
    MW2:
    MW1654 (ackA)
    RF122:
    SAB1570c (ackA)
    ST398:
    SAPIG1764 (ackA)
    T0131:
    SAT0131_01814 (mntA)
    TCH60:
    HMPREF0772_11441 (ackA)
    TW20:
    SATW20_17020 (ackA)
    USA300_TCH1516:
    USA300HOU_1698 (ackA)
    VC40:
    SAVC_07765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVNGEKVKTVQDIKD
    N315            MSKLILAINAGSSSLKFQLIRMPEEELVTKGLIERIGLKDSIFTIEVNGEKVKTVQDIKD
    NCTC8325        MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVNGEKVKTVQDIKD
    Newman          MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVNGEKVKTVQDIKD
    USA300_FPR3757  MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVNGEKVKTVQDIKD
                    ********************************:***************************

    COL             HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
    N315            HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
    NCTC8325        HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
    Newman          HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
    USA300_FPR3757  HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
                    ************************************************************

    COL             LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
    N315            LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
    NCTC8325        LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
    Newman          LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
    USA300_FPR3757  LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
                    ************************************************************

    COL             TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
    N315            TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
    NCTC8325        TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
    Newman          TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
    USA300_FPR3757  TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
                    ************************************************************

    COL             SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
    N315            SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
    NCTC8325        SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
    Newman          SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
    USA300_FPR3757  SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
                    ************************************************************

    COL             LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
    N315            LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
    NCTC8325        LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
    Newman          LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
    USA300_FPR3757  LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
                    ************************************************************

    COL             LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
    N315            LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
    NCTC8325        LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
    Newman          LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
    USA300_FPR3757  LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
                    ****************************************