From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004366000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • sulfite exporter TauE/SafE-like protein
    • membrane spanning protein
    • putative membrane protein YfcA
    • sulfite exporter TauE/SafE family protein
    • transporter
  • strand?: -
  • coordinates?: 4605804..4606244
  • synteny block?: BlockID0033710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1672
    08BA02176:
    C248_1755
    11819-97:
    MS7_1720
    71193:
    ST398NM01_1767
    ECT-R 2:
    ECTR2_1554
    ED133:
    SAOV_1701
    ED98:
    SAAV_1724
    HO 5096 0412:
    SAEMRSA15_16230
    JH1:
    SaurJH1_1805
    JH9:
    SaurJH9_1770
    JKD6008:
    SAA6008_01682
    JKD6159:
    SAA6159_01638
    LGA251:
    SARLGA251_16050
    M013:
    M013TW_1727
    MRSA252:
    SAR1792
    MSHR1132:
    SAMSHR1132_15640
    MSSA476:
    SAS1641
    Mu3:
    SAHV_1700
    Mu50:
    SAV1714
    MW2:
    MW1657
    RF122:
    SAB1573c
    ST398:
    SAPIG1767
    T0131:
    SAT0131_01817 (tagA)
    TCH60:
    HMPREF0772_11438
    TW20:
    SATW20_17050
    USA300_TCH1516:
    USA300HOU_1701
    VC40:
    SAVC_07780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
    N315            MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
    NCTC8325        MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
    Newman          MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
    USA300_FPR3757  MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
                    ************************************************************

    COL             STIKFIRSGKVDLYVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
    N315            SMIKFIRSGKVDLFVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
    NCTC8325        STIKFIRSGKVDLYVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
    Newman          STIKFIRSGKVDLYVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
    USA300_FPR3757  STIKFIRSGKVDLYVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
                    * ***********:**********************************************

    COL             KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
    N315            KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
    NCTC8325        KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
    Newman          KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
    USA300_FPR3757  KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
                    ************************************************************

    COL             KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYAGAHFAIKQGVGYVKVLFIIIT
    N315            KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYTGAHFAIKQGVGYVKVLFIIIT
    NCTC8325        KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYAGAHFAIKQGVGYVKVLFIIIT
    Newman          KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYAGAHFAIKQGVGYVKVLFIIIT
    USA300_FPR3757  KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYAGAHFAIKQGVGYVKVLFIIIT
                    **************************************:*********************

    COL             AILILKNAFDYIQQFV
    N315            AILILKNAFDYIQQFV
    NCTC8325        AILILKNAFDYIQQFV
    Newman          AILILKNAFDYIQQFV
    USA300_FPR3757  AILILKNAFDYIQQFV
                    ****************