From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004367000
  • symbol?: thiI
  • description?: thiamine biosynthesis protein ThiI

      descriptions from strain specific annotations:

    • thiamine biosynthesis protein ThiI
    • thiamine biosynthesis/tRNA modification protein ThiI
    • putative thiamine biosynthesis protein
    • tRNA sulfurtransferase
  • strand?: -
  • coordinates?: 4606624..4607847
  • synteny block?: BlockID0033720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1764 (thiI)
    N315:
    NCTC8325:
    Newman:
    NWMN_1609 (thiI)
    USA300_FPR3757:
    04-02981:
    SA2981_1673 (thiI)
    08BA02176:
    C248_1756 (thiI)
    11819-97:
    MS7_1721 (thiI)
    71193:
    ST398NM01_1768
    ECT-R 2:
    ECTR2_1555 (thiI)
    ED133:
    SAOV_1702
    ED98:
    SAAV_1725 (thiI)
    HO 5096 0412:
    SAEMRSA15_16240 (thiI)
    JH1:
    SaurJH1_1806
    JH9:
    SaurJH9_1771
    JKD6008:
    SAA6008_01683 (thiI)
    JKD6159:
    SAA6159_01639 (thiI)
    LGA251:
    SARLGA251_16060 (thiI)
    M013:
    M013TW_1728
    MRSA252:
    SAR1793 (thiI)
    MSHR1132:
    SAMSHR1132_15650
    MSSA476:
    SAS1642
    Mu3:
    SAHV_1701
    Mu50:
    SAV1715
    MW2:
    MW1658
    RF122:
    SAB1574c
    ST398:
    SAPIG1768 (thiI)
    T0131:
    SAT0131_01818 (tagH)
    TCH60:
    HMPREF0772_11437 (thiI)
    TW20:
    SATW20_17060 (thiI)
    USA300_TCH1516:
    USA300HOU_1702 (thiI)
    VC40:
    SAVC_07785

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
    N315            MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
    NCTC8325        MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
    Newman          MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
    USA300_FPR3757  MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
                    ************************************************************

    COL             NEITYRLSKIFGIKSISPVLKVEKTIEAISAAAIKFAQQFEENSTFKIDVKRADKNFPMD
    N315            NEITYRLSKIFGIKSISPVLKVEKTIEAMSAAAIKFAQQFEENSTFKIDVKRADKNFPMD
    NCTC8325        NEITYRLSKIFGIKSISPVLKVEKTIEAISAAAIKFAQQFEENSTFKIDVKRADKNFPMD
    Newman          NEITYRLSKIFGIKSISPVLKVEKTIEAISAAAIKFAQQFEENSTFKIDVKRADKNFPMD
    USA300_FPR3757  NEITYRLSKIFGIKSISPVLKVEKTIEAISAAAIKFAQQFEENSTFKIDVKRADKNFPMD
                    ****************************:*******************************

    COL             TYELQRELGGAVLKHFDNISVNVKRPDHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
    N315            TYELQRELGGTVLKQIENVSVNVKRADHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
    NCTC8325        TYELQRELGGAVLKHFDNISVNVKRPDHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
    Newman          TYELQRELGGAVLKHFDNISVNVKRPDHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
    USA300_FPR3757  TYELQRELGGAVLKHFDNISVNVKRPDHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
                    **********:***:::*:******.**********************************

    COL             LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
    N315            LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
    NCTC8325        LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
    Newman          LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
    USA300_FPR3757  LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
                    ************************************************************

    COL             IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
    N315            IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
    NCTC8325        IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
    Newman          IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
    USA300_FPR3757  IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
                    ************************************************************

    COL             MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFD
    N315            MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFE
    NCTC8325        MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFD
    Newman          MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFD
    USA300_FPR3757  MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFD
                    ***********************************************************:

    COL             KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL
    N315            KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL
    NCTC8325        KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL
    Newman          KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL
    USA300_FPR3757  KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL
                    ***********************************************