From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan004371000
  • symbol?:
  • description?: GAF domain-containing protein

      descriptions from strain specific annotations:

    • GAF domain-containing protein
    • GAF domain protein
  • strand?: +
  • coordinates?: 4611402..4611866
  • synteny block?: BlockID0033760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1677
    08BA02176:
    C248_1759
    11819-97:
    MS7_1725
    71193:
    ST398NM01_1771
    ECT-R 2:
    ECTR2_1559
    ED133:
    SAOV_1705
    ED98:
    SAAV_1729
    HO 5096 0412:
    SAEMRSA15_16270
    JH1:
    SaurJH1_1809
    JH9:
    SaurJH9_1774
    JKD6008:
    SAA6008_01687
    JKD6159:
    SAA6159_01642
    LGA251:
    SARLGA251_16090
    M013:
    M013TW_1731
    MRSA252:
    SAR1796
    MSHR1132:
    SAMSHR1132_15680
    MSSA476:
    SAS1645
    Mu3:
    SAHV_1704
    Mu50:
    SAV1718
    MW2:
    MW1661
    RF122:
    SAB1577
    ST398:
    SAPIG1771
    T0131:
    SAT0131_01822
    TCH60:
    HMPREF0772_11434
    TW20:
    SATW20_17090
    USA300_TCH1516:
    USA300HOU_1706
    VC40:
    SAVC_07800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILG
    N315            MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLNQINWVGFYLLEQNELILG
    NCTC8325        MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILG
    Newman          MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILG
    USA300_FPR3757  MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILG
                    *****************************************:******************

    COL             PFQGHPACVHIPIGKGVCGTAVSERRTQIVADVHQFEGHIACDANSKSEIVVPIFKDDKI
    N315            PFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFEGHIACDANSKSEIVVPIFKDDKI
    NCTC8325        PFQGHPACVHIPIGKGVCGTAVSERRTQIVADVHQFEGHIACDANSKSEIVVPIFKDDKI
    Newman          PFQGHPACVHIPIGKGVCGTAVSERRTQIVADVHQFEGHIACDANSKSEIVVPIFKDDKI
    USA300_FPR3757  PFQGHPACVHIPIGKGVCGTAVSERRTQIVADVHQFEGHIACDANSKSEIVVPIFKDDKI
                    ****************************:*******************************

    COL             IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
    N315            IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
    NCTC8325        IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
    Newman          IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
    USA300_FPR3757  IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
                    **********************************