From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004398000
  • symbol?: acuA
  • description?: acetoin utilization protein AcuA

      descriptions from strain specific annotations:

    • acetoin utilization protein AcuA
    • acetoin utilization protein
    • Acetyltransferase AcuA, acetyl-CoA synthetase inhibitor
    • acetoin dehydrogenase-like protein
  • strand?: +
  • coordinates?: 4638612..4639244
  • synteny block?: BlockID0034020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1784 (acuA)
    N315:
    SA1555 (acuA)
    NCTC8325:
    Newman:
    NWMN_1627 (acuA)
    USA300_FPR3757:
    04-02981:
    SA2981_1692 (acuA)
    08BA02176:
    C248_1778 (acuA)
    11819-97:
    MS7_1740
    71193:
    ST398NM01_1786
    ECT-R 2:
    ECTR2_1574
    ED133:
    SAOV_1720 (acuA)
    ED98:
    SAAV_1744 (acuA)
    HO 5096 0412:
    SAEMRSA15_16420 (acuA)
    JH1:
    SaurJH1_1824
    JH9:
    SaurJH9_1789
    JKD6008:
    SAA6008_01704 (acuA)
    JKD6159:
    SAA6159_01657 (acuA)
    LGA251:
    SARLGA251_16240 (acuA)
    M013:
    M013TW_1748
    MRSA252:
    SAR1812 (acuA)
    MSHR1132:
    SAMSHR1132_15840
    MSSA476:
    SAS1660
    Mu3:
    SAHV_1720 (acuA)
    Mu50:
    SAV1734 (acuA)
    MW2:
    MW1677 (acuA)
    RF122:
    SAB1594 (acuA)
    ST398:
    SAPIG1786
    T0131:
    SAT0131_01838
    TCH60:
    HMPREF0772_11419 (acuA)
    TW20:
    SATW20_17240 (acuA)
    USA300_TCH1516:
    USA300HOU_1723 (acuA)
    VC40:
    SAVC_07880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHLKTYQSEDYYIHDKQFVIEGPLTHEDLKALTFDAHLTAFRDAEDQYKALLEITTLPE
    N315            MNHLKTYQSEDYYIHDKQFVIEGPLTYEDLKALTFDAHLTAFRDAEDQYEALLEITTLPE
    NCTC8325        MNHLKTYQSEDYYIHDKQFVIEGPLTHEDLKALTFDAHLTAFRDAEDQYKALLEITTLPE
    Newman          MNHLKTYQSEDYYIHDKQFVIEGPLTHEDLKALTFDAHLTAFRDAEDQYKALLEITTLPE
    USA300_FPR3757  MNHLKTYQSEDYYIHDKQFVIEGPLTHEDLKALTFDAHLTAFRDAEDQYKALLEITTLPE
                    **************************:**********************:**********

    COL             GRIYVARQDQLIVGYVTFHYPDEIERWSTGKLPYLIELGAIEVSINFRQLQLAEKLIQLS
    N315            GRIYVARQDELIVGYVTFHYPDEIERWSTGNLPYLIELGAIEVSINFRQLHLAEKLIQLS
    NCTC8325        GRIYVARQDQLIVGYVTFHYPDEIERWSTGKLPYLIELGAIEVSINFRQLQLAEKLIQLS
    Newman          GRIYVARQDQLIVGYVTFHYPDEIERWSTGKLPYLIELGAIEVSINFRQLQLAEKLIQLS
    USA300_FPR3757  GRIYVARQDQLIVGYVTFHYPDEIERWSTGKLPYLIELGAIEVSINFRQLQLAEKLIQLS
                    *********:********************:*******************:*********

    COL             LSTPEFENYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPA
    N315            LSTPEFEDYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPA
    NCTC8325        LSTPEFENYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPA
    Newman          LSTPEFENYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPA
    USA300_FPR3757  LSTPEFENYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPA
                    *******:****************************************************

    COL             NCLMARIGKNITLEQQQAFDDIRYMNRFFF
    N315            NCLMARIGKNITLEQQQAFDDIRYMNRFFF
    NCTC8325        NCLMARIGKNITLEQQQAFDDIRYMNRFFF
    Newman          NCLMARIGKNITLEQQQAFDDIRYMNRFFF
    USA300_FPR3757  NCLMARIGKNITLEQQQAFDDIRYMNRFFF
                    ******************************