From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004409000
  • symbol?:
  • description?: phenylalanyl-tRNA synthetase-like protein

      descriptions from strain specific annotations:

    • phenylalanyl-tRNA synthetase-like protein
    • phenylalanyl-tRNA synthetase (beta subunit)
    • tRNA-binding domain-containing protein
    • phenylalanine--tRNA ligase beta subunit
    • putative tRNA binding domain protein
    • putative tRNA-binding protein
    • T-RNA-binding domain protein
    • phenylalanyl-tRNA synthetase beta subunit
    • phenylalanyl-tRNA synthetase subunit beta
  • strand?: -
  • coordinates?: 4656745..4657383
  • synteny block?: BlockID0034130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1700
    08BA02176:
    C248_1787
    11819-97:
    MS7_1748
    71193:
    ST398NM01_1795
    ECT-R 2:
    ECTR2_1582
    ED133:
    SAOV_1728
    ED98:
    SAAV_1752
    HO 5096 0412:
    SAEMRSA15_16500
    JH1:
    SaurJH1_1832
    JH9:
    SaurJH9_1797
    JKD6008:
    SAA6008_01713 (pheT2)
    JKD6159:
    SAA6159_01665 (pheT2)
    LGA251:
    SARLGA251_16320
    M013:
    M013TW_1756
    MRSA252:
    SAR1820
    MSHR1132:
    SAMSHR1132_15920
    MSSA476:
    SAS1668
    Mu3:
    SAHV_1728
    Mu50:
    SAV1742
    MW2:
    MW1685
    RF122:
    SAB1602c
    ST398:
    SAPIG1795
    T0131:
    SAT0131_01850
    TCH60:
    HMPREF0772_11411
    TW20:
    SATW20_17320
    USA300_TCH1516:
    USA300HOU_1732 (pheT2)
    VC40:
    SAVC_07920

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKG
    N315            MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKG
    NCTC8325        MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKG
    Newman          MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKG
    USA300_FPR3757  MNLFYNPKYVGDVAFLQIEPVEGELNYNKKGNVVEITNEGNVVGYNIFEISKDITIEEKG
                    ************************************************************

    COL             HIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGND
    N315            HIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGND
    NCTC8325        HIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGND
    Newman          HIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGND
    USA300_FPR3757  HIKLTDELVNVFQKRISEAGFDYKLNADLSPKFVVGYVETKDKHPDADKLSVLNVNVGND
                    ************************************************************

    COL             TLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEE
    N315            TLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEE
    NCTC8325        TLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEE
    Newman          TLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEE
    USA300_FPR3757  TLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELNLPNAPEE
                    ************************************************************

    COL             KGIMVLNDSYEIGQAFFE
    N315            KGIMVLNDSYEIGQAFFE
    NCTC8325        KGIMVLNDSYEIGQAFFE
    Newman          KGIMVLNDSYEIGQAFFE
    USA300_FPR3757  KGIMVLNDSYEIGQAFFE
                    ******************