From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004410000
  • symbol?:
  • description?: protein BCE33L4443
  • strand?: -
  • coordinates?: 4657412..4658254
  • synteny block?: BlockID0034140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1701
    08BA02176:
    C248_1788
    11819-97:
    MS7_1749
    71193:
    ST398NM01_1796
    ECT-R 2:
    ECTR2_1583
    ED133:
    SAOV_1729
    ED98:
    SAAV_1753
    HO 5096 0412:
    SAEMRSA15_16510
    JH1:
    SaurJH1_1833
    JH9:
    SaurJH9_1798
    JKD6008:
    SAA6008_01714
    JKD6159:
    SAA6159_01666
    LGA251:
    SARLGA251_16330
    M013:
    M013TW_1757
    MRSA252:
    SAR1821
    MSHR1132:
    SAMSHR1132_15930
    MSSA476:
    SAS1669
    Mu3:
    SAHV_1729
    Mu50:
    SAV1743
    MW2:
    MW1686
    RF122:
    SAB1603c
    ST398:
    SAPIG1796
    T0131:
    SAT0131_01851
    TCH60:
    HMPREF0772_11410
    TW20:
    SATW20_17330
    USA300_TCH1516:
    USA300HOU_1733
    VC40:
    SAVC_07925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTFQMRDKLKERLSHLDVDFKFNREEETLRIYRTDNNKGITIKLNAIVAKYEDKKEKIV
    N315            MNTFQMRDKLKERLSHLDVDFKFNREEETLRIYRTDNNKGITIKLNAIVAKYEDKKEKIV
    NCTC8325        MNTFQMRDKLKERLSHLDVDFKFNREEETLRIYRTDNNKGITIKLNAIVAKYEDKKEKIV
    Newman          MNTFQMRDKLKERLSHLDVDFKFNREEETLRIYRTDNNKGITIKLNAIVAKYEDKKEKIV
    USA300_FPR3757  MNTFQMRDKLKERLSHLDVDFKFNREEETLRIYRTDNNKGITIKLNAIVAKYEDKKEKIV
                    ************************************************************

    COL             DEIVYYVDEAIAQMADKTLESISSSQIMPVIRATSFDKKTKQGVPFIYDEHTAETAVYYA
    N315            DEIVYYVDEAIAQMADKTLESISSSQIMPVIRATSFDKKTKQGVPFIYDEHTAETAVYYA
    NCTC8325        DEIVYYVDEAIAQMADKTLESISSSQIMPVIRATSFDKKTKQGVPFIYDEHTAETAVYYA
    Newman          DEIVYYVDEAIAQMADKTLESISSSQIMPVIRATSFDKKTKQGVPFIYDEHTAETAVYYA
    USA300_FPR3757  DEIVYYVDEAIAQMADKTLESISSSQIMPVIRATSFDKKTKQGVPFIYDEHTAETAVYYA
                    ************************************************************

    COL             VDLGKSYRLIDESMLEDLKLTEQQIREMSLFNVRKLSNSYTTDEVKGNIFYFINSNDGYD
    N315            VDLGKSYRLIDESMLEDLKLTEQQIREMSLFNVRKLSNSYTTDEVKGNIFYFINSNDGYD
    NCTC8325        VDLGKSYRLIDESMLEDLKLTEQQIREMSLFNVRKLSNSYTTDEVKGNIFYFINSNDGYD
    Newman          VDLGKSYRLIDESMLEDLKLTEQQIREMSLFNVRKLSNSYTTDEVKGNIFYFINSNDGYD
    USA300_FPR3757  VDLGKSYRLIDESMLEDLKLTEQQIREMSLFNVRKLSNSYTTDEVKGNIFYFINSNDGYD
                    ************************************************************

    COL             ASRILNTAFLNEIEAQCQGEMLVAVPHQDVLIIADIRNKTGYDVMAHLTMEFFTKGLVPI
    N315            ASRILNTAFLNEIEAQCQGEMLVAVPHQDVLIIADIRNKTGYDVMAHLTMEFFTKGLVPI
    NCTC8325        ASRILNTAFLNEIEAQCQGEMLVAVPHQDVLIIADIRNKTGYDVMAHLTMEFFTKGLVPI
    Newman          ASRILNTAFLNEIEAQCQGEMLVAVPHQDVLIIADIRNKTGYDVMAHLTMEFFTKGLVPI
    USA300_FPR3757  ASRILNTAFLNEIEAQCQGEMLVAVPHQDVLIIADIRNKTGYDVMAHLTMEFFTKGLVPI
                    ************************************************************

    COL             TSLSFGYKQGHLEPIFILGKNNKQKRDPNVIQRLEANRRKFDKDK
    N315            TSLSFGYKQGHLEPIFILGKNNKQKRDPNVIQRLEANRRKFNKDK
    NCTC8325        TSLSFGYKQGHLEPIFILGKNNKQKRDPNVIQRLEANRRKFNKDK
    Newman          TSLSFGYKQGHLEPIFILGKNNKQKRDPNVIQRLEANRRKFNKDK
    USA300_FPR3757  TSLSFGYKQGHLEPIFILGKNNKQKRDPNVIQRLEANRRKFNKDK
                    *****************************************:***