From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004411000
  • symbol?:
  • description?: thiol reductase thioredoxin

      descriptions from strain specific annotations:

    • thiol reductase thioredoxin
    • thioredoxin
    • thioredoxin-like protein
    • putative thioredoxin
    • thioredoxin, putative
    • thioredoxin domain-containing protein
    • Thioredoxin domain protein
    • thioredoxin family protein
  • strand?: -
  • coordinates?: 4658369..4658680
  • synteny block?: BlockID0034150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1702
    08BA02176:
    C248_1789
    11819-97:
    MS7_1750
    71193:
    ST398NM01_1797
    ECT-R 2:
    ECTR2_1584
    ED133:
    SAOV_1730
    ED98:
    SAAV_1754
    HO 5096 0412:
    SAEMRSA15_16520
    JH1:
    SaurJH1_1834
    JH9:
    SaurJH9_1799
    JKD6008:
    SAA6008_01715
    JKD6159:
    SAA6159_01667
    LGA251:
    SARLGA251_16340
    M013:
    M013TW_1758
    MRSA252:
    SAR1822
    MSHR1132:
    SAMSHR1132_15940
    MSSA476:
    SAS1670
    Mu3:
    SAHV_1730
    Mu50:
    SAV1744
    MW2:
    MW1687
    RF122:
    SAB1604c
    ST398:
    SAPIG1797
    T0131:
    SAT0131_01852
    TCH60:
    HMPREF0772_11409
    TW20:
    SATW20_17340
    USA300_TCH1516:
    USA300HOU_1734
    VC40:
    SAVC_07930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDI
    N315            MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDI
    NCTC8325        MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDI
    Newman          MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDI
    USA300_FPR3757  MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDI
                    ************************************************************

    COL             CIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
    N315            CIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
    NCTC8325        CIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
    Newman          CIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
    USA300_FPR3757  CIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
                    *******************************************