From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004412000
  • symbol?:
  • description?: glutamyl aminopeptidase

      descriptions from strain specific annotations:

    • glutamyl aminopeptidase
    • Deblocking aminopeptidase
    • endo-1,4-beta-glucanase-like protein
    • glutamyl aminopeptidase, Deblocking aminopeptidase
    • M42 family glutamyl aminopeptidase
    • peptidase M20/M25/M40 family protein
    • putative aminopeptidase
  • strand?: -
  • coordinates?: 4658752..4659828
  • synteny block?: BlockID0034160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1795 (pepA1)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1703
    08BA02176:
    C248_1790
    11819-97:
    MS7_1751
    71193:
    ST398NM01_1798
    ECT-R 2:
    ECTR2_1585
    ED133:
    SAOV_1731
    ED98:
    SAAV_1755 (pepA1)
    HO 5096 0412:
    SAEMRSA15_16530
    JH1:
    SaurJH1_1835
    JH9:
    SaurJH9_1800
    JKD6008:
    SAA6008_01716 (pepA1)
    JKD6159:
    SAA6159_01668 (pepA1)
    LGA251:
    SARLGA251_16350
    M013:
    M013TW_1759
    MRSA252:
    SAR1823
    MSHR1132:
    SAMSHR1132_15950
    MSSA476:
    SAS1671
    Mu3:
    SAHV_1731
    Mu50:
    SAV1745
    MW2:
    MW1688
    RF122:
    SAB1605c
    ST398:
    SAPIG1798
    T0131:
    SAT0131_01853
    TCH60:
    HMPREF0772_11408 (pepA2)
    TW20:
    SATW20_17350
    USA300_TCH1516:
    USA300HOU_1735 (pepA1)
    VC40:
    SAVC_07935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNINKKVTLQRIQTLTELHGAPGFEEEVKNYMTQQMAPYVDEFIENRMGGFFGVKKSKNP
    N315            MNINKKVTLQRIQTLTELHGAPGFEEEVKNYMTQQMAPYVDEFIENRMGGFFGVKKSKNP
    NCTC8325        MNINKKVTLQRIQTLTELHGAPGFEEEVKNYMTQQMAPYVDEFIENRMGGFFGVKKSKNP
    Newman          MNINKKVTLQRIQTLTELHGAPGFEEEVKNYMTQQMAPYVDEFIENRMGGFFGVKKSKNP
    USA300_FPR3757  MNINKKVTLQRIQTLTELHGAPGFEEEVKNYMTQQMAPYVDEFIENRMGGFFGVKKSKNP
                    ************************************************************

    COL             NAKRVMIAAHMDEIGFMITNITKNGMIQFTNLGGVANDIWQGQRLVIKNRNGDKIIGVVS
    N315            NAKRVMIAAHMDEIGFMITNITKNGMIQFTNLGGVANDIWQGQRLVIKNRNGDKIIGVVS
    NCTC8325        NAKRVMIAAHMDEIGFMITNITKNGMIQFTNLGGVANDIWQGQRLVIKNRNGDKIIGVVS
    Newman          NAKRVMIAAHMDEIGFMITNITKNGMIQFTNLGGVANDIWQGQRLVIKNRNGDKIIGVVS
    USA300_FPR3757  NAKRVMIAAHMDEIGFMITNITKNGMIQFTNLGGVANDIWQGQRLVIKNRNGDKIIGVVS
                    ************************************************************

    COL             NIPKHFRTGSEGAPEIKDLTLDIGAQNEDEVRERGIDIGDTIVPHTPFTQLSEHRYSAKA
    N315            NIPKHFRTGSEGAPEIKDLTLDIGAQNEDEVRERGIDIGDTIVPHTPFTQLSEHRYSAKA
    NCTC8325        NIPKHFRTGSEGAPEIKDLTLDIGAQNEDEVRERGIDIGDTIVPHTPFTQLSEHRYSAKA
    Newman          NIPKHFRTGSEGAPEIKDLTLDIGAQNEDEVRERGIDIGDTIVPHTPFTQLSEHRYSAKA
    USA300_FPR3757  NIPKHFRTGSEGAPEIKDLTLDIGAQNEDEVRERGIDIGDTIVPHTPFTQLSEHRYSAKA
                    ************************************************************

    COL             WDNRYGCVLAIEILELLKDIELDVDLYVGANVQEEVGLRGAKASAEMIDPDVAFVVDCSP
    N315            WDNRYGCVLAIEILELLKDIELDVDLYVGANVQEEVGLRGAKASAEMIDPDVAFVVDCSP
    NCTC8325        WDNRYGCVLAIEILELLKDIELDVDLYVGANVQEEVGLRGAKASAEMIDPDVAFVVDCSP
    Newman          WDNRYGCVLAIEILELLKDIELDVDLYVGANVQEEVGLRGAKASAEMIDPDVAFVVDCSP
    USA300_FPR3757  WDNRYGCVLAIEILELLKDIELDVDLYVGANVQEEVGLRGAKASAEMIDPDVAFVVDCSP
                    ************************************************************

    COL             ANDVKGNQPLSGELGKGTLIRIKDGTMILKPVFRDYLLKLVEAHDIEHQYYMSPGGTDGG
    N315            ANDVKGNQPLSGELGKGTLIRIKDGTMILKPVFRDYLLKLVEAHDIEHQYYMSPGGTDGG
    NCTC8325        ANDVKGNQPLSGELGKGTLIRIKDGTMILKPVFRDYLLKLVEAHDIEHQYYMSPGGTDGG
    Newman          ANDVKGNQPLSGELGKGTLIRIKDGTMILKPVFRDYLLKLVEAHDIEHQYYMSPGGTDGG
    USA300_FPR3757  ANDVKGNQPLSGELGKGTLIRIKDGTMILKPVFRDYLLKLVEAHDIEHQYYMSPGGTDGG
                    ************************************************************

    COL             EIHKANIGIPTAVIGVCARYIHSTDSVFDIRDYFAARSLLSEAICNLDNNQIETLQYK
    N315            EIHKANIGIPTAVIGVCARYIHSTDSVFDIRDYFAARSLLSEAICNLDNNQIETLQYK
    NCTC8325        EIHKANIGIPTAVIGVCARYIHSTDSVFDIRDYFAARSLLSEAICNLDNNQIETLQYK
    Newman          EIHKANIGIPTAVIGVCARYIHSTDSVFDIRDYFAARSLLSEAICNLDNNQIETLQYK
    USA300_FPR3757  EIHKANIGIPTAVIGVCARYIHSTDSVFDIRDYFAARSLLSEAICNLDNNQIETLQYK
                    **********************************************************